DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and CG30323

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_725729.2 Gene:CG30323 / 246539 FlyBaseID:FBgn0050323 Length:306 Species:Drosophila melanogaster


Alignment Length:231 Identity:51/231 - (22%)
Similarity:85/231 - (36%) Gaps:68/231 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 NMCGGTILSNRWIITAAHCLQD-PKS---------NLWKVLIHVGKVKSFDDKEIVVNRSYTIVH 107
            :.|.|::||..|::|:..|:.. |:|         ||..|:....::|....|.|     |.:..
  Fly    52 HFCAGSLLSAWWVVTSGCCVSTRPESTPNQPSNRKNLRVVVFTPKRLKKPSPKNI-----YHVQK 111

  Fly   108 KKFDRKTVT--NDIALIKLPKKLTFNKYIQPAKLPSAKKTYTGRKAIISGWG------------- 157
            ...|...::  .::||:||.:.:|..::...........|:.....   |||             
  Fly   112 IVLDESAISGCTELALLKLDRGVTGQRFAMMLPEKELNSTWLCNSL---GWGRIYYVSYVYISAM 173

  Fly   158 -----------LTTKQ---LPSQVLQYIRAPIISNKECERQWNKQLGGKSKKVVHNGFICIDS-- 206
                       :|..|   ..|:::| |||..||..||:...::.|             |:.|  
  Fly   174 CPAFSMVYDNPVTWFQDGPYSSELIQ-IRAQKISEYECKPDCSRCL-------------CMTSYT 224

  Fly   207 KKGLPCRGDSGGPMVLDDGSRTLVGIVS--HGFDGE 240
            .:|..|:.|.|.|:..|   ..|.|:..  |..|.|
  Fly   225 GRGNMCQQDLGSPLFCD---HFLYGVARRVHTCDDE 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 51/231 (22%)
Tryp_SPc 24..260 CDD:238113 51/231 (22%)
CG30323NP_725729.2 Tryp_SPc 45..275 CDD:304450 51/231 (22%)
Tryp_SPc 45..272 CDD:214473 51/231 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471258
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.