DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and CG30286

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_726082.3 Gene:CG30286 / 246529 FlyBaseID:FBgn0050286 Length:277 Species:Drosophila melanogaster


Alignment Length:234 Identity:65/234 - (27%)
Similarity:113/234 - (48%) Gaps:52/234 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 MCGGTILSNRWIITAAHCLQDPKSNLWKVLIHVGKVKSF--------------DDKEIVVNRSYT 104
            :||||::::|:|:|||||:::.::    :.:.:|:..|.              :|.||.|    .
  Fly    59 VCGGTLVNHRFILTAAHCIREDEN----LTVRLGEFNSLTSIDCNGSDCLPPSEDFEIDV----A 115

  Fly   105 IVHKKFDRKTVTNDIALIKLPKKLTFNKYIQPAKL-------PSAKKTYTGRKAIISGWGLTTKQ 162
            ..|..:.|....:||.|::|.|.:.:..:|:|..|       |..::.:   :.:.:|||.:..:
  Fly   116 FRHGGYSRTNRIHDIGLLRLAKSVEYKVHIKPICLITNTTLQPKIERLH---RLVATGWGRSPSE 177

  Fly   163 LPSQVLQYIRAPIISNKECER-QWNKQLGGKSKKVVHNGFICIDSKKGLPCRGDSGGPM---VLD 223
            ..:.:|:.||...::...|.: .|..:         ....||:..:.|:.|.|||||||   :..
  Fly   178 AANHILKSIRVTRVNWGVCSKTYWVDR---------RRDQICVSHESGVSCSGDSGGPMGQAIRL 233

  Fly   224 DGSRTL---VGIVSHGFDGECKLKLPDVSTRVSSYLKWI 259
            || |.|   |||||:| :.||  ..|.|.|.|..::.||
  Fly   234 DG-RVLFVQVGIVSYG-NAEC--LSPSVFTNVMEHIDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 63/232 (27%)
Tryp_SPc 24..260 CDD:238113 65/234 (28%)
CG30286NP_726082.3 Tryp_SPc 39..269 CDD:238113 65/234 (28%)
Tryp_SPc 39..268 CDD:214473 63/232 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436467
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.