DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and CG30082

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster


Alignment Length:267 Identity:72/267 - (26%)
Similarity:112/267 - (41%) Gaps:64/267 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTILSNRWIITAAHCLQDPKSNLWKVLIHVG 87
            ||:.|..|.....|:    |.|..  |:...:|.||:::.|:::||||||..         .|:.
  Fly    39 RIVGGRTADIGSNPW----LAYLH--KNSSLVCTGTLITKRFVLTAAHCLHS---------FHLL 88

  Fly    88 KVK--SFDD---------------KEIVVNRSYTIVHKKF-DRKTVTNDIALIKLPKKLTFNKYI 134
            .|:  .:|.               :|..|..:|  :|..| .|:...|||.|:||...:.:..:|
  Fly    89 TVRLGEYDTSTRIDCTSEFCIPTYEEYSVENAY--IHTFFGGRQDSRNDIGLLKLNGTVVYKLFI 151

  Fly   135 Q-------PAKLPSAKKTYTGRKAIISGWGLTTKQLPSQVLQYIRAPIISNKECERQWNKQLGGK 192
            :       |.::|.: .||..     :|||.......:.|||.:....:...:|||.....|.  
  Fly   152 RPICLFRDPGQVPYS-STYEA-----AGWGKIDLINTATVLQTVNLIRLDQSDCERSLRTSLS-- 208

  Fly   193 SKKVVHNGFICIDSKKGLPCRGDSGGPM--VLDDG--SRTL-VGIVSHGFDGECKLKLPDVSTRV 252
                  .|..|....:...|.||||||:  .:.:|  :||: :||||:   |....:.|.|.|.|
  Fly   209 ------YGQFCAGQWRADTCSGDSGGPLSRKMSNGRITRTVQLGIVSY---GHYLCRGPGVYTYV 264

  Fly   253 SSYLKWI 259
            .|:..||
  Fly   265 PSFTNWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 70/265 (26%)
Tryp_SPc 24..260 CDD:238113 71/266 (27%)
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 70/265 (26%)
Tryp_SPc 40..274 CDD:238113 71/266 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436470
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.