DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and Cela2a

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_036685.1 Gene:Cela2a / 24332 RGDID:2548 Length:271 Species:Rattus norvegicus


Alignment Length:275 Identity:86/275 - (31%)
Similarity:130/275 - (47%) Gaps:27/275 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MILQLVL--IVQFSLVFGQETGSL-----RIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGT 58
            ||..|:|  :|..:|..|..|..:     |::.|..|.....|:||.|. |....|.. :.|||:
  Rat     1 MIRTLLLSALVAGALSCGYPTYEVQHDVSRVVGGQEASPNSWPWQVSLQ-YLSSGKWH-HTCGGS 63

  Fly    59 ILSNRWIITAAHCLQDPKSNLWKVLIHVGKVKSFDDKEIVVNRSYTIVHKKFDRKTVT--NDIAL 121
            :::|.|::|||||:.:  |..::||:....:.:.:...:.|..|..:||:|::.:.::  |||||
  Rat    64 LVANNWVLTAAHCISN--SRTYRVLLGRHSLSTSESGSLAVQVSKLVVHEKWNAQKLSNGNDIAL 126

  Fly   122 IKLPKKLTFNKYIQPAKLPSAKKTYTGR-KAIISGWG-LTTKQLPSQVLQYIRAPIISNKECERQ 184
            :||...:.....||.|.||.|....... ...::||| |.|......|||..|..::....|...
  Rat   127 VKLASPVALTSKIQTACLPPAGTILPNNYPCYVTGWGRLQTNGATPDVLQQGRLLVVDYATCSSA 191

  Fly   185 --WNKQLGGKSKKVVHNGFICIDSKKGLPCRGDSGGPM--VLDDGSRTLVGIVSHGFDGECKL-K 244
              |...:  |:..|...|.....|     |.||||||:  ...:|...:.||||.|....|.. :
  Rat   192 SWWGSSV--KTNMVCAGGDGVTSS-----CNGDSGGPLNCQASNGQWQVHGIVSFGSTLGCNYPR 249

  Fly   245 LPDVSTRVSSYLKWI 259
            .|.|.||||:|:.||
  Rat   250 KPSVFTRVSNYIDWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 76/244 (31%)
Tryp_SPc 24..260 CDD:238113 77/245 (31%)
Cela2aNP_036685.1 Tryp_SPc 30..264 CDD:214473 76/244 (31%)
Tryp_SPc 31..267 CDD:238113 77/245 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4367
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.