DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and Ctrb1

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_036668.1 Gene:Ctrb1 / 24291 RGDID:2444 Length:263 Species:Rattus norvegicus


Alignment Length:277 Identity:88/277 - (31%)
Similarity:128/277 - (46%) Gaps:44/277 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LVLIVQFSLV---FG--------QETGSLRIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGT 58
            |.|:..|:||   ||        ..||..||:||..|.....|:||.|     ..|...:.|||:
  Rat     4 LWLVSCFALVGATFGCGVPTIQPVLTGLSRIVNGEDAIPGSWPWQVSL-----QDKTGFHFCGGS 63

  Fly    59 ILSNRWIITAAHC---LQDPKSNLWKVLIHVGKVKSFDDKE--IVVNRSYTIVHKKFDRKTVTND 118
            ::|..|::|||||   ..|        ::..|:.....|:|  .|:..:....:.||:..||.||
  Rat    64 LISEDWVVTAAHCGVKTSD--------VVVAGEFDQGSDEENIQVLKIAQVFKNPKFNMFTVRND 120

  Fly   119 IALIKLPKKLTFNKYIQPAKLPSAKKTY-TGRKAIISGWGLT---TKQLPSQVLQYIRAPIISNK 179
            |.|:||.....|::.:....||:....: .|.....:|||.|   ..:.|.: ||....||:|..
  Rat   121 ITLLKLATPAQFSETVSAVCLPNVDDDFPPGTVCATTGWGKTKYNALKTPEK-LQQAALPIVSEA 184

  Fly   180 ECERQWNKQLGGKSKKVVHNGFICIDSKKGLPCRGDSGGPMVLD-DGSRTLVGIVSHGFDGECKL 243
            :|::.|    |.|...|:    .|..:.....|.||||||:|.. ||..||.||||.| .|.|..
  Rat   185 DCKKSW----GSKITDVM----TCAGASGVSSCMGDSGGPLVCQKDGVWTLAGIVSWG-SGVCST 240

  Fly   244 KLPDVSTRVSSYLKWIK 260
            ..|.|.:||::.:.|::
  Rat   241 STPAVYSRVTALMPWVQ 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 78/245 (32%)
Tryp_SPc 24..260 CDD:238113 78/245 (32%)
Ctrb1NP_036668.1 Tryp_SPc 33..256 CDD:214473 78/245 (32%)
Tryp_SPc 34..259 CDD:238113 78/247 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4367
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.970

Return to query results.
Submit another query.