DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and Cela3a

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001119790.1 Gene:Cela3a / 242711 MGIID:3651647 Length:283 Species:Mus musculus


Alignment Length:281 Identity:88/281 - (31%)
Similarity:136/281 - (48%) Gaps:29/281 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ILQLVLIVQFSLVFGQ--ETGSLRIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTILSNRW 64
            :|..:|:|..:...||  ...|.|::||..|.....|:||.|.....||..  :.|||::::..|
Mouse     4 LLSSLLLVALASGCGQPSHNPSSRVVNGEEAVPHSWPWQVSLQYEMGGSFH--HTCGGSLITPDW 66

  Fly    65 IITAAHCLQDPKSNLWKVLI--HVGKVKSFDDKEIVVNRSYTIVHKKFDRKTVT--NDIALIKLP 125
            ::||.||:. |..| ::|::  |...|:...::.|.:|.....||.|::.:.|.  |:|||:||.
Mouse    67 VLTAGHCIM-PYLN-YRVVLGEHEHGVEEGSEQVIPINAGELFVHPKWNSECVNCGNNIALVKLS 129

  Fly   126 KKLTFNKYIQPAKLPSAKKTY-TGRKAIISGWG--LTTKQLPSQVLQYIRAPIISNKECER--QW 185
            :.......:|.|.||.|.:.. .|....|||||  .|...||:: ||....|::..:.|.|  .|
Mouse   130 RSAQLGDAVQLACLPPAGEILPNGAPCYISGWGRLSTNGPLPTK-LQQALLPVVDYEHCSRWDWW 193

  Fly   186 NKQLGGKSKKVVHNGFICIDSKKG--------LPCRGDSGGPM--VLDDGSRTLVGIVSHGFDGE 240
            ...:  |...|...|:|...|...        .|.:||||||:  ..|:|:..:.||.|......
Mouse   194 GHYV--KRTMVCAGGYIQAHSLSSDTHQPRLLSPLQGDSGGPLNCPADNGTWQVHGIASFVSPSG 256

  Fly   241 CK-LKLPDVSTRVSSYLKWIK 260
            |. ||.|.:.||||:::.||:
Mouse   257 CNTLKKPTMFTRVSAFIDWIE 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 80/255 (31%)
Tryp_SPc 24..260 CDD:238113 80/255 (31%)
Cela3aNP_001119790.1 Tryp_SPc 27..276 CDD:214473 80/255 (31%)
Tryp_SPc 28..279 CDD:238113 81/257 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 147 1.000 Inparanoid score I4390
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.