DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and TPSD1

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_036349.1 Gene:TPSD1 / 23430 HGNCID:14118 Length:242 Species:Homo sapiens


Alignment Length:214 Identity:61/214 - (28%)
Similarity:110/214 - (51%) Gaps:20/214 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 QETGSLRIMNGTAAKAKQLPYQVGLLC---YFEGSKDEPNMCGGTILSNRWIITAAHCLQDPKSN 78
            |:||   |:.|..|...:.|:||.|..   |:      .:.|||:::..:|::|||||::....:
Human    34 QQTG---IVGGQEAPRSKWPWQVSLRVRGPYW------MHFCGGSLIHPQWVLTAAHCVEPDIKD 89

  Fly    79 LWKVLIHVGKVK-SFDDKEIVVNRSYTIVHKKFDRKTVTNDIALIKLPKKLTFNKYIQPAKLPSA 142
            |..:.:.:.:.. .:.|:.:.|:|  .|||.:|.......||||::|.:.:..:.:|....||.|
Human    90 LAALRVQLREQHLYYQDQLLPVSR--IIVHPQFYIIQTGADIALLELEEPVNISSHIHTVTLPPA 152

  Fly   143 KKTY-TGRKAIISGWGLTTKQL---PSQVLQYIRAPIISNKECERQWNKQL-GGKSKKVVHNGFI 202
            .:|: .|....::|||.....:   |...|:.:..|::.|..|..:::..| .|.|.::|.:..:
Human   153 SETFPPGMPCWVTGWGDVDNNVHLPPPYPLKEVEVPVVENHLCNAEYHTGLHTGHSFQIVRDDML 217

  Fly   203 CIDSKKGLPCRGDSGGPMV 221
            |..|:....|:||||||:|
Human   218 CAGSENHDSCQGDSGGPLV 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 58/208 (28%)
Tryp_SPc 24..260 CDD:238113 58/207 (28%)
TPSD1NP_036349.1 Tryp_SPc 38..242 CDD:238113 58/207 (28%)
Tryp_SPc 38..240 CDD:214473 58/207 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.