DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and T22A3.6

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_492773.3 Gene:T22A3.6 / 188711 WormBaseID:WBGene00011909 Length:491 Species:Caenorhabditis elegans


Alignment Length:97 Identity:22/97 - (22%)
Similarity:35/97 - (36%) Gaps:36/97 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 SFDDKEI-----------VVNRSYTIVHKKFDRK---TVTNDIALIKLPKKLTFNKYIQPAKLPS 141
            ||::.||           ::....||....|.|:   :..:|:|...|                .
 Worm   278 SFNEHEIFTYQQGILLDAIIEDELTISGCTFWRRCFSSCQDDLATCWL----------------K 326

  Fly   142 AKKTYTGRKAI-ISG-----WGLTTKQLPSQV 167
            ::|.|.|.||. :||     |...|.::.|.|
 Worm   327 SQKGYFGSKATSVSGKQCIPWTQATSEILSMV 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 22/97 (23%)
Tryp_SPc 24..260 CDD:238113 22/97 (23%)
T22A3.6NP_492773.3 KR 98..173 CDD:350900
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.