DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and try-4

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_508030.4 Gene:try-4 / 185148 WormBaseID:WBGene00006622 Length:324 Species:Caenorhabditis elegans


Alignment Length:298 Identity:73/298 - (24%)
Similarity:114/298 - (38%) Gaps:92/298 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 AKAKQLPYQVGLLCYFEGSKDEPNMCGGTILSNRWIITAAH------------C----LQDPKSN 78
            :|.|..|:.|..      :.|..|..||:|:|...||||||            |    .:.|.|:
 Worm    53 SKIKNFPWAVSF------TVDGVNRLGGSIISPYHIITAAHGFITTIGSRGNLCENKNWKKPNSS 111

  Fly    79 LWKVLIHVGKVKSFDDKEIVVN-----RSYT-------------IVHKKFDRKTVT--------- 116
            :::      .:|...|...|..     |.:|             ::|.|.....|.         
 Worm   112 IYR------SIKFLRDTRKVAYGGTCIRGHTDKYPNDPRCKKSDVIHNKVRAVLVDGEFASSNCL 170

  Fly   117 --NDIALIKLPKKLTFNKYIQPAKLPSAKKTYTGRKAIISGWGLTTKQLPSQVLQYI-------- 171
              :|.|::::.|::.|::.::|..||.....|| :...:.|||.:          ||        
 Worm   171 KGHDWAIVEVEKRIHFSENVRPICLPRPNMYYT-KSLAVPGWGRS----------YIFNESGPLI 224

  Fly   172 -RAPIISNKECERQWNKQLGGKSKKVVHNGFICIDSKK----GLP--CRGDSGGPMVLDD---GS 226
             ..|:..:::|:|.|:.:|...:     :.|||..|..    ..|  |.|||||.:...|   |.
 Worm   225 HEIPMRIDRDCKRPWSDRLPADA-----DDFICATSMNVSNYSAPRTCHGDSGGGLEYRDDNYGR 284

  Fly   227 RTLVGIVSHGFDGECKLKLPDVSTRVSSYLKWIKYYSG 264
            ..|:.|.|.|..| |...:....|||..||..|..|:|
 Worm   285 AFLIAITSFGTRG-CPSNMLARFTRVDMYLNLICNYTG 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 70/291 (24%)
Tryp_SPc 24..260 CDD:238113 70/292 (24%)
try-4NP_508030.4 Tryp_SPc 51..318 CDD:238113 71/293 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.