DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and try-3

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001367393.1 Gene:try-3 / 183420 WormBaseID:WBGene00006621 Length:313 Species:Caenorhabditis elegans


Alignment Length:274 Identity:79/274 - (28%)
Similarity:127/274 - (46%) Gaps:63/274 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SLRIMNGTAA------KAKQLPYQVGLLCYFEGSKDEPNMCGGTILSNRWIITAAHC-------- 71
            |.||:.|.:.      .||.:.|         |...:..:||.|::.:.|::|||||        
 Worm    35 SFRIIGGNSIDDGANWMAKLVSY---------GDNGQGILCGATVIDDFWLVTAAHCALQLQTRS 90

  Fly    72 ---LQDPKSNLWKVLIHVGKVKSFDDKEIVVNRSYTIVHKKFDRKTVTNDIALIKLPKKLTFNKY 133
               :::||:|         :.:||..||       ..:|..::.:|..|||||:::...|: ...
 Worm    91 FVYVREPKNN---------RERSFSVKE-------AYIHSGYNNQTADNDIALLRISSDLS-KLG 138

  Fly   134 IQPAKL--PSAKKTYTGRKAIISGWGLT--------TKQLPSQVLQYIRAPIISNKECERQWNKQ 188
            |:|..|  ..:|.....:..::.|:|||        .|.:.||.||....||||:.:|.:.| :.
 Worm   139 IKPVCLVHDDSKLLKQYKNGVVIGYGLTLGEDSSGEPKLINSQTLQSTSVPIISDDDCVKTW-RF 202

  Fly   189 LGGKSKKVVHNGF-ICIDSKKGLPCRGDSGGPMVL--DDGSRTLVGIVSHGFDGECKL----KLP 246
            |...|.|:  .|: ||..:.......||||||:::  .:|....:||.|:|.||...:    |.|
 Worm   203 LSLLSVKI--TGYQICAGAYLHGTAPGDSGGPLLIHKSNGEYVQIGITSYGADGLDGVIDQGKFP 265

  Fly   247 DVSTRVSSYLKWIK 260
            .|.||:|.|:.||:
 Worm   266 GVYTRISKYVPWIQ 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 76/269 (28%)
Tryp_SPc 24..260 CDD:238113 76/269 (28%)
try-3NP_001367393.1 Tryp_SPc 38..279 CDD:238113 76/269 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.