DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and F9

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_032005.1 Gene:F9 / 14071 MGIID:88384 Length:471 Species:Mus musculus


Alignment Length:253 Identity:83/253 - (32%)
Similarity:126/253 - (49%) Gaps:38/253 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTILSNRWIITAAHCLQDPKSNLWKVLIHVG 87
            |::.|..||..|:|:||.|....|.      .|||.|::.:||:||||||:...    |:.:..|
Mouse   236 RVVGGENAKPGQIPWQVILNGEIEA------FCGGAIINEKWIVTAAHCLKPGD----KIEVVAG 290

  Fly    88 KVKSFDDKEIVVNRS---YTIVHKKFDR--KTVTNDIALIKLPKKLTFNKYIQPAKLPSAKKTYT 147
            :. :.|.||....|.   .||.|.:::.  ...::||||::|.|.|..|.|:.|  :..|.:.||
Mouse   291 EY-NIDKKEDTEQRRNVIRTIPHHQYNATINKYSHDIALLELDKPLILNSYVTP--ICVANREYT 352

  Fly   148 G-----RKAIISGWG-LTTKQLPSQVLQYIRAPIISNKECERQWNKQLGGKSKKVVHNGFICIDS 206
            .     ....:|||| :..|...:.:|||:|.|::....|.|        .:...::|...|...
Mouse   353 NIFLKFGSGYVSGWGKVFNKGRQASILQYLRVPLVDRATCLR--------STTFTIYNNMFCAGY 409

  Fly   207 KKG--LPCRGDSGGPMVLD-DGSRTLVGIVSHGFDGECKLK-LPDVSTRVSSYLKWIK 260
            ::|  ..|.||||||.|.: :|:..|.||:|.|  .||.:| ...:.|:||.|:.|||
Mouse   410 REGGKDSCEGDSGGPHVTEVEGTSFLTGIISWG--EECAMKGKYGIYTKVSRYVNWIK 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 80/250 (32%)
Tryp_SPc 24..260 CDD:238113 80/250 (32%)
F9NP_032005.1 GLA 28..92 CDD:214503
EGF_CA 93..129 CDD:238011
FXa_inhibition 134..170 CDD:291342
Tryp_SPc 236..464 CDD:214473 80/250 (32%)
Tryp_SPc 237..467 CDD:238113 82/252 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.