DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and Cela2a

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_031945.1 Gene:Cela2a / 13706 MGIID:95316 Length:271 Species:Mus musculus


Alignment Length:279 Identity:89/279 - (31%)
Similarity:132/279 - (47%) Gaps:35/279 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MILQLVL--IVQFSLVFGQETGSL-----RIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGT 58
            ||..|:|  :|..:|..|..|..:     |::.|..|.....|:||.|.....|.  ..:.|||:
Mouse     1 MIRTLLLSALVAGALSCGYPTYEVEDDVSRVVGGQEATPNTWPWQVSLQVLSSGR--WRHNCGGS 63

  Fly    59 ILSNRWIITAAHCLQDPKSNLWKVLIHVGKVKSFDDKEIVVNRSYTIVHKKFDRKTVTN--DIAL 121
            :::|.|::||||||.:.::  ::||:....:.:.......|..|..:||::::.:.|.|  ||||
Mouse    64 LVANNWVLTAAHCLSNYQT--YRVLLGAHSLSNPGAGSAAVQVSKLVVHQRWNSQNVGNGYDIAL 126

  Fly   122 IKLPKKLTFNKYIQPAKLPSA----KKTYTGRKAIISGWGL--TTKQLPSQVLQYIRAPIISNKE 180
            |||...:|.:|.||.|.||.|    .:.|.   ..::||||  |....| ..|:..|..::....
Mouse   127 IKLASPVTLSKNIQTACLPPAGTILPRNYV---CYVTGWGLLQTNGNSP-DTLRQGRLLVVDYAT 187

  Fly   181 CERQ--WNKQLGGKSKKVVHNGFICIDSKKGLPCRGDSGGPM--VLDDGSRTLVGIVSHGFDGEC 241
            |...  |...:  ||..|...|.....|     |.||||||:  ...:|...:.||||.|....|
Mouse   188 CSSASWWGSSV--KSSMVCAGGDGVTSS-----CNGDSGGPLNCRASNGQWQVHGIVSFGSSLGC 245

  Fly   242 KL-KLPDVSTRVSSYLKWI 259
            .. :.|.|.||||:|:.||
Mouse   246 NYPRKPSVFTRVSNYIDWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 79/248 (32%)
Tryp_SPc 24..260 CDD:238113 80/249 (32%)
Cela2aNP_031945.1 Tryp_SPc 30..264 CDD:214473 79/248 (32%)
Tryp_SPc 31..267 CDD:238113 80/249 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 147 1.000 Inparanoid score I4390
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.