DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and CG43335

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster


Alignment Length:250 Identity:73/250 - (29%)
Similarity:117/250 - (46%) Gaps:31/250 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTILSNRWIITAAHCLQDPKSNLWKVLIHVG 87
            ||:.|:.|:....|:...|...|.      ..|.||:::|::::|||||::..| ||...|...|
  Fly    41 RIIGGSDAEITSHPWMAYLYNEFH------YFCAGTLITNQFVLTAAHCIEASK-NLTVRLGGSG 98

  Fly    88 KVKSFDDKEIVVNRSYT----IVHKKFDRKTVTNDIALIKLPKKLTFNKYIQPAKL---PSAKKT 145
            ..:|......:....|:    |.||.|....:.||||:|:|.:.:.|..:|:|..:   |:.:..
  Fly    99 LTRSDGSMCQITAEDYSVSMAIKHKYFTPSIMLNDIAMIRLARTVKFYDHIRPICIILDPAVRLL 163

  Fly   146 Y-TGRKAIISGWGLTTKQLPSQVLQYIRAPIISNKECERQWNKQLGGKSKKVVHNGFICIDSKKG 209
            . .|...:.:||||..|::...:||.....:::...|.:.::        ..:..|.||...|:.
  Fly   164 LEDGMTLMATGWGLADKRMHPHLLQEAPITVMNRNVCSKLYD--------VAITQGQICAGDKET 220

  Fly   210 LPCRGDSGGPM---VLDDGSRTLV--GIVSHGFDGECKLKLPDVSTRVSSYLKWI 259
            ..|.||||||:   |...|....|  ||.|.| |.||  :.|.:.|.:|:|..||
  Fly   221 NTCLGDSGGPLGGVVNYYGDLRFVQYGITSFG-DIEC--RSPSIYTDLSTYSGWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 71/248 (29%)
Tryp_SPc 24..260 CDD:238113 71/248 (29%)
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 71/248 (29%)
Tryp_SPc 42..275 CDD:238113 71/248 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436459
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.