DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and CG43110

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster


Alignment Length:265 Identity:73/265 - (27%)
Similarity:107/265 - (40%) Gaps:46/265 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FSLVFGQETGSL---RIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTILSNRWIITAAHCL 72
            :|:...|..|..   :|::|:.|..:...|..|:.      .....:|||||:...:::|.||| 
  Fly    20 YSMFLKQPCGKTPVPKIISGSNASQQSAQYMAGIF------NTTHLLCGGTIIHEDFVLTVAHC- 77

  Fly    73 QDPKSNLWKVLIHVG--KVKSFDDKEIVVNRSYTIVHKKFDRKTVTNDIALIKLPKKLTFNKYIQ 135
                .:...:.:.:|  .:....|:..|:.   ||.|.::...|..|||||:||.:.:.||..||
  Fly    78 ----KSTQTLFVRLGAYNINHPTDQIRVIE---TIAHPQYSNSTYANDIALVKLERSVIFNLNIQ 135

  Fly   136 P------AKLPSAKKTYTGRKAIISGWGLTTKQLPSQVLQYIRAPIISNKECERQWNKQLGGKSK 194
            |      |.|....:.|..     .|||.|.....|.:||.|.....:...|..........|. 
  Fly   136 PICIHLDATLGKQIRYYNA-----FGWGRTRNAEQSDILQRIFVNRTNPMICHLYLGMSPDPKQ- 194

  Fly   195 KVVHNGFICIDSKKGLPCRGDSGGPMVLD---DGSR--TLVGIVSHGFDGECKLKLPDVSTRVSS 254
                   ||..:.:|..|.||||||::..   .|..  |..||.|:| ..||  ....:.|.||.
  Fly   195 -------ICATTDQGDTCAGDSGGPLISKITYQGKNFDTQFGITSYG-TREC--NGVGLYTDVSQ 249

  Fly   255 YLKWI 259
            |..||
  Fly   250 YSGWI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 68/248 (27%)
Tryp_SPc 24..260 CDD:238113 70/249 (28%)
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 68/248 (27%)
Tryp_SPc 36..257 CDD:238113 70/249 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436478
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.