DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and CG43125

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster


Alignment Length:278 Identity:59/278 - (21%)
Similarity:101/278 - (36%) Gaps:109/278 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 LLCYFEGS---------------------KDEPNM-----CGGTILSNRWIITAAHCLQDPKSNL 79
            ||.:::||                     |..|.:     |.||:::.|:::|||.|: |.::.|
  Fly    12 LLLFYQGSALFLEQNCGKSSVFSPAPWLVKIRPELSSNITCTGTLINERFVLTAASCI-DYQTEL 75

  Fly    80 WKVLIHVGKV-------KSFDDKEIVVNRSYTIVHKKFDRKTVTNDIALIKLPKKLTFNKYIQP- 136
               ::.:|::       .....:||.|.|:  ::|:.:..::...:|||::|...:.:.|.||| 
  Fly    76 ---IVRLGEIDGTLQNSSKLQYEEIYVARA--LIHRSYSSESHQYNIALLRLKTSVVYKKNIQPI 135

  Fly   137 ------AKLPSA-------------KKTYTGRKAIISGWGLTTKQLPSQVLQYIRAP----IISN 178
                  .|:|.|             ||...|.......|.|:        |..:|.|    |:..
  Fly   136 CIDVNVGKVPKAPTFEIEKKKNEEPKKNKAGIMKRFLNWFLS--------LFGVREPRPDVILPP 192

  Fly   179 KECERQW--NKQLGGKSKKVVHNGFICIDSKKGLPCRGDSGGPMVLDDGSRTLVGIVSHGFDGEC 241
            :.....|  .||:  ....:.|.                              .||:||. :.|.
  Fly   193 QPIAVGWPLTKQI--NESALFHQ------------------------------YGILSHR-NSES 224

  Fly   242 KLKLPDVSTRVSSYLKWI 259
            |   .||.|.|.:|:.||
  Fly   225 K---KDVYTDVMAYVNWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 57/276 (21%)
Tryp_SPc 24..260 CDD:238113 59/278 (21%)
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 26/105 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436479
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.