DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and Ctrl

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_446461.1 Gene:Ctrl / 117184 RGDID:621501 Length:264 Species:Rattus norvegicus


Alignment Length:277 Identity:77/277 - (27%)
Similarity:129/277 - (46%) Gaps:43/277 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LVLIVQFSLV-FGQETG------------SLRIMNGTAAKAKQLPYQVGLLCYFEGSKDEP--NM 54
            |:|.:..||| .|...|            :.||:||..|.....|:||.|       :|..  :.
  Rat     2 LLLSLTLSLVLLGSSWGCGVPAITPALSYNQRIVNGENAVPGSWPWQVSL-------QDNTGFHF 59

  Fly    55 CGGTILSNRWIITAAHCLQDPKSNLWKVLIHVGKVKSFDDKE--IVVNRSYTIVHKKFDRKTVTN 117
            |||::::..|::|||||...|..:    .:.:|:.....:.|  .|::.|..|.|..::..|:.|
  Rat    60 CGGSLIAPNWVVTAAHCKVTPGRH----FVILGEYDRSSNAEPIQVLSISKAITHPSWNPNTMNN 120

  Fly   118 DIALIKLPKKLTFNKYIQPAKLPSAKKTY-TGRKAIISGWGLTT---KQLPSQVLQYIRAPIISN 178
            |:.|:||.....:...:.|..|.|:.:.. .|...:.:|||..:   ...|:: ||.:..|:::.
  Rat   121 DLTLLKLASPARYTAQVSPVCLASSNEALPAGLTCVTTGWGRISGVGNVTPAR-LQQVVLPLVTV 184

  Fly   179 KECERQWNKQLGGKSKKVVHNGFICIDSKKGLPCRGDSGGPMVLDDGSR-TLVGIVSHGFDGECK 242
            .:|.:.|..:        :.:..||........|:||||||:|...|:. .|:||||.|.: .|.
  Rat   185 NQCRQYWGSR--------ITDSMICAGGAGASSCQGDSGGPLVCQKGNTWVLIGIVSWGTE-NCN 240

  Fly   243 LKLPDVSTRVSSYLKWI 259
            ::.|.:.||||.:..||
  Rat   241 VQAPAMYTRVSKFNTWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 68/244 (28%)
Tryp_SPc 24..260 CDD:238113 69/245 (28%)
CtrlNP_446461.1 Tryp_SPc 33..257 CDD:214473 68/244 (28%)
Tryp_SPc 34..260 CDD:238113 69/245 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4367
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.970

Return to query results.
Submit another query.