DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and Prss29

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_444490.2 Gene:Prss29 / 114662 MGIID:2149952 Length:279 Species:Mus musculus


Alignment Length:274 Identity:86/274 - (31%)
Similarity:142/274 - (51%) Gaps:18/274 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MILQLVLIVQF-------SLVFGQETGSLRIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGT 58
            |::||.|.:.|       :...|.|...:.|:.|.:|...:.|:||.|..|........:.|||:
Mouse     1 MLIQLCLTLFFLGCSIAGTPAPGPEGVLMGIVGGHSAPQGKWPWQVSLRIYRYYWAFWVHNCGGS 65

  Fly    59 ILSNRWIITAAHCLQDPKSNLWKVLIHVGKVKSFDDKEIVVNRSYTIVHKKFDRKTVTNDIALIK 123
            |:..:|::|||||:::..::.....|.||:...:..||: ::.|..|:|..|....:.:|:||::
Mouse    66 IIHPQWVLTAAHCIRERDADPSVFRIRVGEAYLYGGKEL-LSVSRVIIHPDFVHAGLGSDVALLQ 129

  Fly   124 LPKKLTFNKYIQPAKLPSAKKTYTGRKAI-ISGWGL--TTKQLPSQV-LQYIRAPIISNKECERQ 184
            |...:.....::|.||||.....|.:... ::|||.  |.:.||... ||.::..||.|..||..
Mouse   130 LAVSVQSFPNVKPVKLPSESLEVTKKDVCWVTGWGAVSTHRSLPPPYRLQQVQVKIIDNSLCEEM 194

  Fly   185 WNK--QLGGKSKKVVHNGFICIDSKKGLPCRGDSGGPMVLD-DGSRTLVGIVSHGFDGECKLK-L 245
            ::.  :...:.:|::....:|..::....|.||||||:|.: .||.||||:||.|:.  |.|: .
Mouse   195 YHNATRHRNRGQKLILKDMLCAGNQGQDSCYGDSGGPLVCNVTGSWTLVGVVSWGYG--CALRDF 257

  Fly   246 PDVSTRVSSYLKWI 259
            |.|..||.|:|.||
Mouse   258 PGVYARVQSFLPWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 77/243 (32%)
Tryp_SPc 24..260 CDD:238113 79/244 (32%)
Prss29NP_444490.2 Tryp_SPc 31..274 CDD:238113 79/244 (32%)
Tryp_SPc 31..271 CDD:214473 77/242 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.