DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and Prss28

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_444489.2 Gene:Prss28 / 114661 MGIID:2149951 Length:274 Species:Mus musculus


Alignment Length:269 Identity:83/269 - (30%)
Similarity:135/269 - (50%) Gaps:14/269 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ILQLVLIVQFSLVFGQETGSLR-----IMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTILS 61
            :|.|.|....|.||.......|     |:.|......:.|:||.|..|........::|||:|:.
Mouse     4 LLLLALSCLESTVFMASVSISRSKPVGIVGGQCTPPGKWPWQVSLRMYSYEVNSWVHICGGSIIH 68

  Fly    62 NRWIITAAHCLQDPKSNLWKVLIHVGKVKSFDDKEIVVNRSYTIVHKKFDRKTVTNDIALIKLPK 126
            .:||:|||||:|...::.....:.||:|..:.::|: :|.|..|:|..::..:...|:||::|..
Mouse    69 PQWILTAAHCIQSQDADPAVYRVQVGEVYLYKEQEL-LNISRIIIHPDYNDVSKRFDLALMQLTA 132

  Fly   127 KLTFNKYIQPAKLPSAKKTYTGR-KAIISGWGLTTKQLPSQ---VLQYIRAPIISNKECERQWNK 187
            .|..:..:.|..||....|:... :..:.|||...:::|.|   .|..::.||..||.|:|.:.|
Mouse   133 LLVTSTNVSPVSLPKDSSTFDSTDQCWLVGWGNLLQRVPLQPPYQLHEVKIPIQDNKSCKRAYRK 197

  Fly   188 QLGGKSKKV-VHNGFICIDSKKGLPCRGDSGGPMVLDDGSRTL-VGIVSHGFDGECKLKLPDVST 250
            :...:.|.| :.:..:|..:....||.||||||:|....::.: ||:||.|.|  |...||.:.:
Mouse   198 KSSDEHKAVAIFDDMLCAGTSGRGPCFGDSGGPLVCWKSNKWIQVGVVSKGID--CSNNLPSIFS 260

  Fly   251 RVSSYLKWI 259
            ||.|.|.||
Mouse   261 RVQSSLAWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 75/246 (30%)
Tryp_SPc 24..260 CDD:238113 76/242 (31%)
Prss28NP_444489.2 Tryp_SPc 31..272 CDD:238113 76/242 (31%)
Tryp_SPc 31..269 CDD:214473 74/240 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5902
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.