DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and Cela1

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_291090.2 Gene:Cela1 / 109901 MGIID:95314 Length:266 Species:Mus musculus


Alignment Length:272 Identity:83/272 - (30%)
Similarity:127/272 - (46%) Gaps:31/272 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LVLIVQFSLVF-GQETGSL-----RIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTILSNR 63
            |..:|..|||. |..|..:     |::.|..|:....|.|:.|...:.||..  :.||||::.:.
Mouse     2 LRFLVFASLVLCGHSTEDVPETDARVVGGAEARRNSWPSQISLQYQYGGSWH--HTCGGTLIRSN 64

  Fly    64 WIITAAHCLQDPKSNLWKVLIHVGKVKSFDDKEIVVNRSYTIVHKKFDRKTVT--NDIALIKLPK 126
            |::|||||:..|.:  ::|::....:...|..|..||....:.|..:::..|.  .||||::|.|
Mouse    65 WVMTAAHCVDSPMT--YRVVVGEHNLSQNDGTEQYVNVQKIVSHPYWNKNNVVAGYDIALLRLAK 127

  Fly   127 KLTFNKYIQPAKLPSAKKTYTGRK-AIISGWGLT-TKQLPSQVLQYIRAPIISNKECERQ--WNK 187
            .:|.|.|:|...||.......... ..|:|||.| |....:|.||....|.:|...|...  |  
Mouse   128 SVTLNNYVQLGVLPREGTILANNSPCYITGWGRTRTNGELAQTLQQAYLPSVSYSICSSSSYW-- 190

  Fly   188 QLGGKSKKVVHNGFICIDS---KKGLPCRGDSGGPM-VLDDGSRTLVGIVSHGFDGECKL-KLPD 247
               |.|   |.|..:|...   :.|  |:||||||: .:.:|...:.|:.|......|.: :.|.
Mouse   191 ---GSS---VKNTMVCAGGDGVRSG--CQGDSGGPLHCMVNGQYAVHGVTSFVSSMGCNVARKPT 247

  Fly   248 VSTRVSSYLKWI 259
            |.||||:|:.|:
Mouse   248 VFTRVSAYISWM 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 75/246 (30%)
Tryp_SPc 24..260 CDD:238113 75/247 (30%)
Cela1NP_291090.2 Tryp_SPc 26..258 CDD:214473 75/245 (31%)
Tryp_SPc 27..262 CDD:238113 75/247 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 147 1.000 Inparanoid score I4390
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.