DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and CG42694

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001188994.1 Gene:CG42694 / 10178792 FlyBaseID:FBgn0261584 Length:512 Species:Drosophila melanogaster


Alignment Length:265 Identity:61/265 - (23%)
Similarity:103/265 - (38%) Gaps:57/265 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 IMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTILSNRWIITAAHCLQDPKSNLWKVLIHVGK 88
            |.|.:..|.:| | |.|.|.:.  |.....:|.|:::|.:::::||.|: |...   |:.:.:| 
  Fly    31 ISNQSITKLRQ-P-QAGWLAHI--SNGTHVLCSGSLISKQFVLSAAQCI-DVHG---KLFVQLG- 86

  Fly    89 VKSFDDKEIVVNRS-----YT---IVHKKFDRKTVTNDIALIKLPKKLTFNKYIQPAKLPSAKKT 145
                     |.|.:     ||   :|......|.:..||.|:||.:.:.:|.::.|..:.....|
  Fly    87 ---------VSNATKSPHWYTVSNVVIPSHSGKRLQRDIGLLKLSQSVDYNDFVYPICIALNTNT 142

  Fly   146 YTGRKAI----ISGWGLTTKQLPSQVLQYIRAPIISNKECERQWNKQLGGKSKKVVHNGFICIDS 206
            ....|.:    .|.|....|...:.||..     :|...|:...:..:..|.        ||..|
  Fly   143 LDMVKILQNFTTSAWLSKNKNPQTIVLSQ-----LSRDRCKLNLSGNVTPKE--------ICAAS 194

  Fly   207 -KKGLPCRGDSGGPMV--LDDGS----RTLVGIVSHGF-DGECKLKLPDVSTRVSSYLKWI---- 259
             ::...|..|||..:.  :..||    ..|.||  .|: :|......|.:...|:..:.||    
  Fly   195 LQRNNSCFIDSGSALTQPIIQGSNIVREMLFGI--RGYVNGRSWCSEPAIYIDVAECVGWIETVV 257

  Fly   260 KYYSG 264
            :.|.|
  Fly   258 QQYDG 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 57/254 (22%)
Tryp_SPc 24..260 CDD:238113 59/259 (23%)
CG42694NP_001188994.1 Tryp_SPc 46..256 CDD:304450 52/240 (22%)
Tryp_SPc 46..253 CDD:214473 50/237 (21%)
Tryp_SPc 319..505 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436477
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.