DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and zgc:165423

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_005164170.1 Gene:zgc:165423 / 100101646 ZFINID:ZDB-GENE-070720-11 Length:538 Species:Danio rerio


Alignment Length:257 Identity:89/257 - (34%)
Similarity:130/257 - (50%) Gaps:26/257 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GQETGSLRIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTILSNRWIITAAHCL-QDPKSNL 79
            |:...:.:|:.||.|.|...|:|..|  :..||    :.|||:::|::||::||||. .:|..:.
Zfish    30 GKAPLNTKIVGGTNASAGSWPWQASL--HESGS----HFCGGSLISDQWILSAAHCFPSNPNPSD 88

  Fly    80 WKVLIHVGKVKSFD---DKEIVVNRSYTIVHKKFDRKTVTNDIALIKLPKKLTFNKYIQPAKLPS 141
            :.|  ::|: :|.|   ..|:..:.|..|||..:...|..||:||:.|...:||:.||||..|.:
Zfish    89 YTV--YLGR-QSQDLPNPNEVSKSVSQVIVHPLYQGSTHDNDMALLHLSSPVTFSNYIQPVCLAA 150

  Fly   142 AKKTYTGRKAIISGWGLTTK--QLPS-QVLQYIRAPIISNKECERQWNKQLGGKSKKVVHNGFIC 203
            ...|:......|:|||....  .||| |:||.:..||:.|..|    |...||.|.  :.|..:|
Zfish   151 DGSTFYNDTMWITGWGTIESGVSLPSPQILQEVNVPIVGNNLC----NCLYGGGSS--ITNNMMC 209

  Fly   204 IDSKKG--LPCRGDSGGPMVLDD-GSRTLVGIVSHGFDGECKLKLPDVSTRVSSYLKWIKYY 262
            ....:|  ..|:||||||||:.. .:....|:||.| .|......|.|..|||.|..||..|
Zfish   210 AGLMQGGKDSCQGDSGGPMVIKSFNTWVQAGVVSFG-KGCADPNYPGVYARVSQYQNWISQY 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 85/245 (35%)
Tryp_SPc 24..260 CDD:238113 86/245 (35%)
zgc:165423XP_005164170.1 Tryp_SPc 37..267 CDD:214473 85/245 (35%)
Tryp_SPc 38..269 CDD:238113 87/246 (35%)
Tryp_SPc 299..473 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.