DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and si:dkey-78l4.10

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_017208791.2 Gene:si:dkey-78l4.10 / 100034472 ZFINID:ZDB-GENE-060503-175 Length:262 Species:Danio rerio


Alignment Length:260 Identity:81/260 - (31%)
Similarity:124/260 - (47%) Gaps:29/260 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LVLIVQF--SLVFGQETGSLRIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTILSNRWIIT 67
            |:|:|..  .|.|....|   |:||:.||....||.|.:      ..|..::|||.:::..:::|
Zfish     8 LLLLVSLLPHLTFMAHVG---IVNGSVAKPHSRPYMVSV------QLDGQHICGGFLITEEFVLT 63

  Fly    68 AAHCLQDPKSNLWKVLIHVGKVKSFDDKEIVVNRSYTIVHKKFDRKTVTNDIALIKLPKKLTFNK 132
            |||| .:.:.|| .|::....::.....:.:...|| |.|..::.|.:.|||.:.||.:::|.|.
Zfish    64 AAHC-WNGEENL-TVVVGAHDLRQSMASDRIEVESY-IRHPSYNSKFIWNDIMVFKLKERVTQNS 125

  Fly   133 YIQPAKLPSAKKTYTGRKAI--ISGWGLTTKQLPSQVLQYIRAPIISNKECERQWNKQLGGKSKK 195
            .:....: |.|..:.....:  ::||||.|....|..|......||||.||:.:|.:.. ..|:.
Zfish   126 SVGWISI-SKKNEHVDANTLCSVAGWGLLTNGTLSDCLMEANVYIISNTECKSKWGRHF-SVSQM 188

  Fly   196 VVHNGFICIDSKKGLPCRGDSGGPMVLDDGSRTLVGIVSHGFDGECKL-KLPDVSTRVSSYLKWI 259
            :...|       .|..||.|||||:|..|   |.|||.|.|....|.. |.|:|.|.:|:|..||
Zfish   189 MCTRG-------HGGSCRYDSGGPLVCGD---TAVGITSFGDPHLCNSPKHPNVYTNISAYRPWI 243

  Fly   260  259
            Zfish   244  243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 73/238 (31%)
Tryp_SPc 24..260 CDD:238113 75/239 (31%)
si:dkey-78l4.10XP_017208791.2 Tryp_SPc 26..243 CDD:214473 73/237 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.