DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and zgc:163079

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001077051.2 Gene:zgc:163079 / 100006550 ZFINID:ZDB-GENE-030131-7428 Length:313 Species:Danio rerio


Alignment Length:262 Identity:76/262 - (29%)
Similarity:131/262 - (50%) Gaps:29/262 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VFGQETGSLRIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTILSNRWIITAAHCLQ-DPKS 77
            |.|:...:.:|:.|..|.....|:|..:    .....|...|||::::..|::|.|.... .|.|
Zfish    26 VCGRAPLNTKIIGGLNATQGSWPWQASI----NLKATEEFYCGGSLINKGWVLTTAKVFALMPAS 86

  Fly    78 NLWKVLIHVGKVKSFDDKEIVVNRSYTIVHKKFDRKTVTNDIALIKLPKKLTFNKYIQPAKLPSA 142
            :   :::::|:..........::|:.|.:.|..:..::.:::||:||...:||:.||:|..|.:|
Zfish    87 D---IVVYLGRQTQNGSNPYEISRTVTKIIKHPNYNSLDSNLALLKLSSPVTFSDYIKPVCLAAA 148

  Fly   143 KKTYT-GRKAIISGWGLTTK-------QLPSQVLQYIRAPIISNKECERQWNKQLGG-KSKKVVH 198
            ...:. |..:.::|||...:       .|| .|||.:.|||::|.||    |...|| .:.|::.
Zfish   149 GSVFVDGTASWVTGWGYLNRPATVEEIMLP-DVLQEVEAPIVNNFEC----NAAYGGIITNKLLC 208

  Fly   199 NGFICIDSKKGLPCRGDSGGPMVLDDGSRTL-VGIVSHGFDGECKLK-LPDVSTRVSSYLKWIKY 261
            .|::..|.|  .||.||.|||:|:..|:..: .|:|..|:   |.|. .|.:..|||.|..||.|
Zfish   209 AGYLNEDGK--APCAGDVGGPLVIKQGAIWIQSGVVVSGY---CGLPGYPTIYVRVSEYEDWISY 268

  Fly   262 YS 263
            |:
Zfish   269 YT 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 70/247 (28%)
Tryp_SPc 24..260 CDD:238113 71/247 (29%)
zgc:163079NP_001077051.2 Tryp_SPc 35..266 CDD:214473 70/247 (28%)
Tryp_SPc 36..267 CDD:238113 71/247 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.