DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and LOC100004427

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_005163955.1 Gene:LOC100004427 / 100004427 -ID:- Length:302 Species:Danio rerio


Alignment Length:256 Identity:77/256 - (30%)
Similarity:130/256 - (50%) Gaps:28/256 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VFGQETGSLRIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTILSNRWIITAAHCLQDPKSN 78
            |.|:...:.:|:.|..|.....|:|..:.....|.    ..|.|:::|.||::|||.|.|  :.|
Zfish    26 VCGRAPLNTKIVGGLNATEGSWPWQASINFKSTGQ----FFCSGSLISERWVLTAASCFQ--RIN 84

  Fly    79 LWKVLIHVGKVKSFDDKEIVVNRSYTIVHKKFDRKTVTNDIALIKLPKKLTFNKYIQPAKLPSAK 143
            :..|:|::|::.:.......:.|  |::     :.:||.||||::|...:||..||:|..|.:|.
Zfish    85 VSDVVIYLGRLTTNGSNPYEIPR--TVI-----QVSVTEDIALVQLSSSVTFTDYIRPVCLAAAG 142

  Fly   144 KTYT-GRKAIISGWGLT--TKQLPSQVLQYIRAPIISNKECERQWNKQLGGKSK--KVVHNGFIC 203
            ..:. |.::.::|||.|  |..:.|.:|:.:.|||::|.||     ..:.|.:.  .|:..||:.
Zfish   143 SVFVDGTESWVTGWGSTSSTNVILSDMLKEVEAPIVNNIEC-----SNINGITNLDNVICAGFVN 202

  Fly   204 IDSKKGLPCRGDSGGPMVLDDGSRTL-VGIVSHGFDGECKLKLPDVSTRVSSYLKWIKYYS 263
            ...|  .||..|.|.|:|...||:.: .|:|...|.|:  ...|.:..|||.|.:||:.|:
Zfish   203 ETGK--APCWEDFGSPLVTRQGSQWIQSGVVVFTFCGQ--NGFPTLYARVSEYEEWIRNYT 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 72/241 (30%)
Tryp_SPc 24..260 CDD:238113 73/241 (30%)
LOC100004427XP_005163955.1 Tryp_SPc 35..255 CDD:214473 72/241 (30%)
Tryp_SPc 36..257 CDD:238113 74/242 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.