DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and zgc:171592

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001104713.2 Gene:zgc:171592 / 100003031 ZFINID:ZDB-GENE-080220-23 Length:260 Species:Danio rerio


Alignment Length:261 Identity:86/261 - (32%)
Similarity:120/261 - (45%) Gaps:50/261 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 QETGSLRIMNGTAAKAKQLPYQVGLLCYFEGSKDEPN---MCGGTILSNRWIITAAHCL------ 72
            |..|| ||:||..|.:...|:||.|        ..||   .|||::::..|::|||||.      
Zfish    25 QIIGS-RIVNGQNAISGSWPWQVSL--------QLPNGVHFCGGSLINRNWVLTAAHCSVVVGYH 80

  Fly    73 ------QDPKSNLWKVLIH-VGKVKSFDDKEIVVNRSYTIVHKKFDRKTVTNDIALIKLPKKLTF 130
                  .|..||...:.:. |.||               :.|..|.|.|:.|||||:||...:|.
Zfish    81 RVVLGEHDRGSNAEPIQVKLVSKV---------------VTHPLFSRTTLNNDIALLKLASPVTL 130

  Fly   131 NKYIQPAKL-PSAKKTYTGRKAIISGWGLTTKQLPSQVLQYIRAPIISNKECERQWNKQLGGKSK 194
            ...:.|..| |||....:|.:...:|||.|......::||....|::|:.:|.:.|     |:::
Zfish   131 TARVSPVCLAPSAINIQSGTRCFTTGWGRTASTSSPRILQQTSVPLVSHADCRQIW-----GRNR 190

  Fly   195 KVVHNGFICIDSKKGLPCRGDSGGPMVLD-DGSRTLVGIVSHGFDGECKLKLPDVSTRVSSYLKW 258
              |.:..||........||||||||:|.: .|..||||.||.|.| .|..:.|.|..|:|....|
Zfish   191 --VTDAMICAGGSGSSSCRGDSGGPLVCERSGVWTLVGSVSWGLD-TCNTRFPGVYARISQQRSW 252

  Fly   259 I 259
            |
Zfish   253 I 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 81/253 (32%)
Tryp_SPc 24..260 CDD:238113 82/254 (32%)
zgc:171592NP_001104713.2 Tryp_SPc 31..256 CDD:238113 82/254 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.