DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssp6 and SLC9A3R2

DIOPT Version :9

Sequence 1:NP_001286952.1 Gene:ssp6 / 38694 FlyBaseID:FBgn0035676 Length:866 Species:Drosophila melanogaster
Sequence 2:XP_016879383.1 Gene:SLC9A3R2 / 9351 HGNCID:11076 Length:372 Species:Homo sapiens


Alignment Length:193 Identity:46/193 - (23%)
Similarity:76/193 - (39%) Gaps:46/193 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 RHKSERYLASNPDEDRRRRTIIVEKKNNSYGFTLQSYGIHYKRDEELEMITYVDYVEYGGPAYRA 176
            |...:|...|.|..:.|.|...:.|....|||.|.|        ::.....|:..|:.|.||.|:
Human   178 RSPPQRLDVSGPLRELRPRLCHLRKGPQGYGFNLHS--------DKSRPGQYIRSVDPGSPAARS 234

  Fly   177 GMREGDVILSINGKDMEKADHKTIVEFIKQCDTRMRMVVLFEDCVRKVDLHMRYIQLQSMLQQKM 241
            |:|..|.::.:||:::|...|..:|..||..:...|::|:..:    .|.|.:.:::..      
Human   235 GLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVDPE----TDEHFKRLRVTP------ 289

  Fly   242 NELERVHLRERELLEGKWKTHSLPARKKANANTSPSDGEGVSPTEVAGEAGFYRPALSTEDVP 304
                     ..|.:||     .||         ||.. .|.||.::.|.:.    ..|..|:|
Human   290 ---------TEEHVEG-----PLP---------SPVT-NGTSPAQLNGGSA----CSSRSDLP 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssp6NP_001286952.1 PDZ_signaling 130..216 CDD:238492 24/85 (28%)
SLC9A3R2XP_016879383.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.