DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssp6 and si:dkey-276j7.2

DIOPT Version :9

Sequence 1:NP_001286952.1 Gene:ssp6 / 38694 FlyBaseID:FBgn0035676 Length:866 Species:Drosophila melanogaster
Sequence 2:XP_017212076.1 Gene:si:dkey-276j7.2 / 792667 ZFINID:ZDB-GENE-131127-420 Length:250 Species:Danio rerio


Alignment Length:207 Identity:43/207 - (20%)
Similarity:79/207 - (38%) Gaps:62/207 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 LSRSTHILGRHKSERYLASNPD-----------EDR------RRRTIIVEKKNNSYGFTLQSYGI 150
            |..:.|.:.|..|:.....|.|           :|:      |:..|:...:|.::||.:|    
Zfish    30 LLNTGHKIQRKTSDCKTTKNKDGKTLTRKVVQTQDKTAEQCIRKSVILRRTENETFGFEIQ---- 90

  Fly   151 HYKRDEELEMITYVDYVEYGGPAYRAGMREGDVILSINGKDMEKADHKTIVEFIKQ--CDTRMRM 213
                    :::..|.:|:....|..:|:...|||:::|.        .:|.||.:|  .|...:.
Zfish    91 --------DLVPCVCFVKEDSLAESSGLMTDDVIIAVNS--------VSIAEFTQQQLKDLFQKA 139

  Fly   214 VVLFEDCVR-----KVDLHMRYIQLQSMLQQKMNELERVHLRERELLEGKWK------------- 260
            .:|..:.||     :..|.:|...||....:|..||:.::..|..|:.|...             
Zfish   140 SILMLEIVRSSTEKQRQLLIRLYLLQREFAEKSAELQTLNTEEVRLIGGVCSVCVCDTRNPQHRH 204

  Fly   261 -----THSLPAR 267
                 :|:||:|
Zfish   205 IISPLSHTLPSR 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssp6NP_001286952.1 PDZ_signaling 130..216 CDD:238492 18/87 (21%)
si:dkey-276j7.2XP_017212076.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.