DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssp6 and pdzd3a

DIOPT Version :9

Sequence 1:NP_001286952.1 Gene:ssp6 / 38694 FlyBaseID:FBgn0035676 Length:866 Species:Drosophila melanogaster
Sequence 2:XP_685398.3 Gene:pdzd3a / 557269 ZFINID:ZDB-GENE-080430-1 Length:520 Species:Danio rerio


Alignment Length:178 Identity:38/178 - (21%)
Similarity:71/178 - (39%) Gaps:49/178 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 GSLGRLKFHKSLDASDEE-------------------IEYAQLSRSTHILGRHKSERYLASNPDE 125
            |:.||.:.:...|...|.                   |.||.|::......:|.:...:.|..:|
Zfish   194 GARGRYRLNPVTDGPAERAGIQNGDRLIWINGVSISVISYAALAKMVKKCEKHLTVLVIDSRSEE 258

  Fly   126 -------------------DRRRRTIIVEKKNNSYGFTLQSYGIHYKRDEELE--MITYV-DYVE 168
                               ..|.:|:.:.:....|||.|        |.|:|.  .|.:: ..::
Zfish   259 IYNRMGLPIIPAFAETHNLPYRPKTLHLTQGPQGYGFLL--------RQEKLRSGRIAHILREID 315

  Fly   169 YGGPAYRAGMREGDVILSINGKDMEKADHKTIVEFIKQCDTRMRMVVL 216
            ...||..|||.:|:::|::||:.:|.|:|:.||..|:|...::.:..:
Zfish   316 PCSPAETAGMEDGEIVLAVNGEQVEDAEHEGIVSKIRQSGQQVTLTTI 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssp6NP_001286952.1 PDZ_signaling 130..216 CDD:238492 25/88 (28%)
pdzd3aXP_685398.3 PDZ_signaling 61..142 CDD:238492
PDZ_signaling 172..252 CDD:238492 10/57 (18%)
PDZ 280..363 CDD:214570 26/90 (29%)
PDZ 408..490 CDD:214570
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.