DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssp6 and PDZK1

DIOPT Version :9

Sequence 1:NP_001286952.1 Gene:ssp6 / 38694 FlyBaseID:FBgn0035676 Length:866 Species:Drosophila melanogaster
Sequence 2:XP_024303384.1 Gene:PDZK1 / 5174 HGNCID:8821 Length:539 Species:Homo sapiens


Alignment Length:270 Identity:59/270 - (21%)
Similarity:110/270 - (40%) Gaps:45/270 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 HYSQSQQQHLYHQSHQQASHYVNGTGSLGRLKF---HKSLDASDEEIEYAQLSRSTHILGRHKSE 116
            |..:...:::...||::....|..:||  |:.|   .|..|....| :..|..|.|      .|.
Human   199 HLIEVNGENVEDASHEEVVEKVKKSGS--RVMFLLVDKETDKRHVE-QKIQFKRET------ASL 254

  Fly   117 RYLASNPDEDRRRRTIIVEKKNNSYGFTLQSYGIHYKRDEELEMITYVDYVEYGGPAYRAGMREG 181
            :.|...|      |.:.::|.:|.|||.|::     ..:::.::|..:|   .|.||..||::..
Human   255 KLLPHQP------RIVEMKKGSNGYGFYLRA-----GSEQKGQIIKDID---SGSPAEEAGLKNN 305

  Fly   182 DVILSINGKDMEKADHKTIVEFIKQCDTRMRMVVLFEDCVRKVDLHMRYIQLQSMLQQKMNELER 246
            |:::::||:.:|..||.::||.|::...:..::|:    .::.|...|.......|         
Human   306 DLVVAVNGESVETLDHDSVVEMIRKGGDQTSLLVV----DKETDNMYRLAHFSPFL--------- 357

  Fly   247 VHLRERELLEGKWKTHSLPARKKANANTSPSDGEGVSPTE-----VAGEAGFYRPALSTEDVPNI 306
             :.:.:||..|..|....|.......::.|...|.|....     ..||.|:.....:...:|..
Human   358 -YYQSQELPNGSVKEAPAPTPTSLEVSSPPDTTEEVDHKPKLCRLAKGENGYGFHLNAIRGLPGS 421

  Fly   307 AARQHGVGGP 316
            ..::...|||
Human   422 FIKEVQKGGP 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssp6NP_001286952.1 PDZ_signaling 130..216 CDD:238492 23/85 (27%)
PDZK1XP_024303384.1 PDZ_signaling 27..107 CDD:238492
PDZ 152..232 CDD:214570 8/34 (24%)
PDZ_signaling 261..340 CDD:238492 24/92 (26%)
PDZ 395..475 CDD:214570 7/37 (19%)
F1-ATPase_gamma <457..>501 CDD:320933
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.