DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssp6 and Pdzd3

DIOPT Version :9

Sequence 1:NP_001286952.1 Gene:ssp6 / 38694 FlyBaseID:FBgn0035676 Length:866 Species:Drosophila melanogaster
Sequence 2:NP_001178925.1 Gene:Pdzd3 / 500986 RGDID:1559807 Length:498 Species:Rattus norvegicus


Alignment Length:404 Identity:77/404 - (19%)
Similarity:125/404 - (30%) Gaps:183/404 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 LASNPDED------RRRRTIIVEKKNNSYGFTLQSYGIHYKRDEELEMITYVDY----VEYGGPA 173
            ||.:.|:.      |.|..::.:::..|:||.||            :.:...|:    |:.|..|
  Rat    32 LAEDQDQSDPWNLHRPRFCLLSKEEEKSFGFHLQ------------QQLGKADHVVCRVDPGSSA 84

  Fly   174 YRAGMREGDVILSINGKDMEKADHKTIVEFIKQCDTRMRMVVLFEDCVRKVDLHMRYIQLQSMLQ 238
            .|.|:||||.||::|...:|..|:..:|.:|:....|:                     |.::|.
  Rat    85 QRQGLREGDRILAVNNNIVEHEDYAVVVRYIRASGPRV---------------------LLTVLA 128

  Fly   239 QKMNELERVHLRERELLEGKWKTHSLPARKKANANTSPSDGEGVSPT---EVAGEAGFYRPALST 300
            |.:.::.|                   |::...|...|:...||.|.   .|..|.||   ..|.
  Rat   129 QHVYDVTR-------------------AQQGNEAFPCPTLASGVRPRLCHVVKDEGGF---GFSV 171

  Fly   301 EDVPNIAARQHGVGGP-------------GIIPPPAQFM---------LTYHYLDPTY-----RY 338
                     .||..||             ..:||.|:.:         .||:.|:...     |.
  Rat   172 ---------THGARGPFWLVLSAGGAAERAGVPPGARLLEVNGICVEKFTYNQLNRKLCQSGDRV 227

  Fly   339 VLRPTHGSSEEFVDGLGLQRSSSDHQPPAQRYVLQQTESVDANSMTQPTTTAPTQYHSTTGGSVK 403
            .|.......||....||:..::    |.|:.:.|                               
  Rat   228 TLLVAGPEVEEQCHQLGMPLAA----PLAEGWAL------------------------------- 257

  Fly   404 PPAPPPRTCEKHKPPAKP--------PK------PEKEKSSGKHCHVGHSCNPCLGHFRWK---- 450
                          ||||        |:      .|::...|:           ||.|.|:    
  Rat   258 --------------PAKPRCLNIEKGPQGFGFLLREEKGPDGR-----------LGQFLWEVDPG 297

  Fly   451 -SAEKSAVPAPDNV 463
             .|:|:.:.|.|.:
  Rat   298 LPADKAGMKAGDRL 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssp6NP_001286952.1 PDZ_signaling 130..216 CDD:238492 23/89 (26%)
Pdzd3NP_001178925.1 PDZ_signaling 47..127 CDD:238492 25/112 (22%)
PDZ_signaling 155..232 CDD:238492 18/88 (20%)
PDZ 260..345 CDD:214570 13/63 (21%)
PDZ_signaling 407..472 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.