DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssp6 and CG10939

DIOPT Version :9

Sequence 1:NP_001286952.1 Gene:ssp6 / 38694 FlyBaseID:FBgn0035676 Length:866 Species:Drosophila melanogaster
Sequence 2:NP_524712.1 Gene:CG10939 / 44155 FlyBaseID:FBgn0010620 Length:296 Species:Drosophila melanogaster


Alignment Length:336 Identity:70/336 - (20%)
Similarity:109/336 - (32%) Gaps:131/336 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 LSRSTHILGRHKSERYLASNPDEDRRRRTIIVEKKNNSYGFTLQSYGIHYKRDEELEMITYVDYV 167
            ::::.||:.|          ||.|             .|||.|.|        |:::...::..|
  Fly    19 VTKTCHIVKR----------PDFD-------------GYGFNLHS--------EKVKPGQFIGKV 52

  Fly   168 EYGGPAYRAGMREGDVILSINGKDMEKADHKTIVEFIKQCDTRMRMVVLFEDCVRKVDLHMRYIQ 232
            :...||..||::|||.||.:||..:....||.:|..||.....:|:::        :|:..:.::
  Fly    53 DADSPAEAAGLKEGDRILEVNGVSIGSETHKQVVARIKAIANEVRLLL--------IDVDGKALE 109

  Fly   233 LQSMLQQKMNELERVHLRERELLEGKWKTHSLPARK-KANANTSPSDGEGVSPTEVAGEAGFYRP 296
            :                          |..|.||.. ..|.:.|.:..||.........|.....
  Fly   110 V--------------------------KPASPPAAACNGNGSASQNGYEGTKQEMPGASANISSI 148

  Fly   297 AL-STEDVPNIAARQHG-----------------VGGP-GIIPPPAQFMLTYHYLDPTYRYVLRP 342
            :: ||:...|.::.|.|                 |..| .|.|||.|                  
  Fly   149 SMVSTKRSSNASSIQSGSTMNASDLDVVDRGIPAVAAPVAITPPPVQ------------------ 195

  Fly   343 THGSSEEF-VDGLGLQRSSSDHQPPAQRYVLQQTESV------DANSMTQPTTTAPTQYHSTTGG 400
             :||.... ::...|.  |:...|.|.:..:....||      ..|.||.|||            
  Fly   196 -NGSKPSSPINNNTLM--STPPPPSATKAGINNNGSVYNTNGNGTNGMTTPTT------------ 245

  Fly   401 SVKPPAPPPRT 411
                  |||.|
  Fly   246 ------PPPPT 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssp6NP_001286952.1 PDZ_signaling 130..216 CDD:238492 24/85 (28%)
CG10939NP_524712.1 PDZ_signaling 20..101 CDD:238492 30/119 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.