Sequence 1: | NP_001286952.1 | Gene: | ssp6 / 38694 | FlyBaseID: | FBgn0035676 | Length: | 866 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_651110.1 | Gene: | CG6688 / 42716 | FlyBaseID: | FBgn0039038 | Length: | 424 | Species: | Drosophila melanogaster |
Alignment Length: | 420 | Identity: | 80/420 - (19%) |
---|---|---|---|
Similarity: | 129/420 - (30%) | Gaps: | 182/420 - (43%) |
- Green bases have known domain annotations that are detailed below.
Fly 145 LQSYGIHYKRDEELEMITYVDYVEYGGPAYRAGMREGDVILSINGKDM-------------EKAD 196
Fly 197 HKTIV----EFIKQCDTR-----------MRMVVLFEDCVRK----------------------- 223
Fly 224 -VDLHMR----------YIQLQSMLQQKM--------------NELER----------VHLRERE 253
Fly 254 LLEGKWKTHS--LPARK----------KANANTSPSDGEGV---SPTEVAG-------------- 289
Fly 290 ------------EAGFYRPALSTEDVPNIAARQHGVGGPGIIPPPAQFMLTYHYLDPTYRYVLRP 342
Fly 343 THGSSEEFVDGLGLQRSSSDHQPPAQRYVLQQTESVDANSMTQPTTTAPTQYHSTTGGSVKPPAP 407
Fly 408 PPRTCEKHKP-------PAK---PPKPEKE 427 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ssp6 | NP_001286952.1 | PDZ_signaling | 130..216 | CDD:238492 | 24/98 (24%) |
CG6688 | NP_651110.1 | PDZ_signaling | 24..104 | CDD:238492 | 17/68 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3528 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |