DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssp6 and CG6688

DIOPT Version :9

Sequence 1:NP_001286952.1 Gene:ssp6 / 38694 FlyBaseID:FBgn0035676 Length:866 Species:Drosophila melanogaster
Sequence 2:NP_651110.1 Gene:CG6688 / 42716 FlyBaseID:FBgn0039038 Length:424 Species:Drosophila melanogaster


Alignment Length:420 Identity:80/420 - (19%)
Similarity:129/420 - (30%) Gaps:182/420 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 LQSYGIHYKRDEELEMITYVDYVEYGGPAYRAGMREGDVILSINGKDM-------------EKAD 196
            :::||....| .:.:...:|..|..|.||...|::.||.:|.:||.|:             .:.|
  Fly    36 MENYGFQLTR-SKWDPYPWVCEVAAGTPAALCGLKPGDCVLEVNGNDVLGLRVSEIAKMVKSQKD 99

  Fly   197 HKTIV----EFIKQCDTR-----------MRMVVLFEDCVRK----------------------- 223
            ..||:    |..|.|||.           .|:.::.|..:|.                       
  Fly   100 CVTILCWNSECDKDCDTNSICCAPMPTSLRRLSLVLESILRLVECPVCGVTISPPAMQCQNGHLL 164

  Fly   224 -VDLHMR----------YIQLQSMLQQKM--------------NELER----------VHLRERE 253
             ||..:|          |...:::|.:::              |:|.:          |..::|.
  Fly   165 CVDCRIRSERCPVCRDFYTPRRALLAEQIFLTIANAFEMCRSENKLRQKLFAGITRPVVGRQDRI 229

  Fly   254 LLEGKWKTHS--LPARK----------KANANTSPSDGEGV---SPTEVAG-------------- 289
            ..:..|:...  ||..|          .:..|.|||:...:   :.|:|||              
  Fly   230 TGQDTWRKRRPVLPTNKFLTKLLEGCAYSTDNLSPSNAATLLRTNTTDVAGDSSEIPARTSPVTA 294

  Fly   290 ------------EAGFYRPALSTEDVPNIAARQHGVGGPGIIPPPAQFMLTYHYLDPTYRYVLRP 342
                        :|....|:|||.|:     :|.||      .|.|:                  
  Fly   295 TPPERTTMHATLDANAAHPSLSTNDL-----QQEGV------KPNAE------------------ 330

  Fly   343 THGSSEEFVDGLGLQRSSSDHQPPAQRYVLQQTESVDANSMTQPTTTAPTQYHSTTGGSVKPPAP 407
              |..||.........::|.|.||....|   :..::.:|..||....|          |.|...
  Fly   331 --GVDEESGTNSSHISATSLHGPPLPASV---SPGINESSGLQPVRIPP----------VTPSQD 380

  Fly   408 PPRTCEKHKP-------PAK---PPKPEKE 427
            .|:...:.||       |.|   |..|.|:
  Fly   381 LPQQVVQTKPASLLYRCPCKLQDPQDPAKD 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssp6NP_001286952.1 PDZ_signaling 130..216 CDD:238492 24/98 (24%)
CG6688NP_651110.1 PDZ_signaling 24..104 CDD:238492 17/68 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.