DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssp6 and Mhcl

DIOPT Version :9

Sequence 1:NP_001286952.1 Gene:ssp6 / 38694 FlyBaseID:FBgn0035676 Length:866 Species:Drosophila melanogaster
Sequence 2:NP_732109.2 Gene:Mhcl / 41955 FlyBaseID:FBgn0026059 Length:2194 Species:Drosophila melanogaster


Alignment Length:424 Identity:83/424 - (19%)
Similarity:141/424 - (33%) Gaps:139/424 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 EIEYAQLSRSTHILGRHKSERYL------------ASNPDEDR-----RRRTII---VEKKNNSY 141
            ::|.|:.:||..:..|..:|..|            |.|..|:|     |.|..:   :|:.....
  Fly  1828 QLEDAESARSLAMKARQTAEAELTEVQAMFDESHRARNDAEERANAAHRDRAELQAQIEENEEEL 1892

  Fly   142 GFTLQSYGIHYK--------------------------RDEELEMITYVDYVEYGGPAYRAGMRE 180
            |..::.|....|                          :::..|:...:|.||..|....|.|.:
  Fly  1893 GELMKKYSATVKQLNTEQINVSEAEFKLNEMEAERNNLKEQVAELQHRLDNVENLGDPSMAMMSK 1957

  Fly   181 GDVILSINGKDMEKA----------------DHKTIVEFIKQCDTRMRM-VVLFEDCVRKVDLHM 228
            .   |.:..|::|..                .||..:|.::...|:.:| .:..:|.::|     
  Fly  1958 R---LELRTKELESRLELEQATRARLEVQVNRHKEALEKLQNEVTQSKMREMQAQDVIKK----- 2014

  Fly   229 RYIQLQSMLQQKMNELERVHLRERELLEGKWKTHSLPARKKANANTSPSDGEG--------VSPT 285
                .|..|:....|...|..||:|         ||..||.........:.||        ::..
  Fly  2015 ----SQKSLRDMREEFHAVSSREQE---------SLTRRKDLEKKVEQMESEGAALKNDLRLALQ 2066

  Fly   286 EVAGEAGFYRPALSTEDVPNIAARQHGVGGPGIIPPPAQFMLTYHYLDPTYRYVLRPTH--GSSE 348
            .:|.    .:.|:..|....::.....:...|.|.            |...|  |||.|  .||:
  Fly  2067 RIAD----LQQAMEEEGEEELSESDESLSSVGSIS------------DLEDR--LRPVHVKRSSQ 2113

  Fly   349 EFVDG-LGLQRSSSDHQPPAQRYVLQQTESV----DANSMTQPTTTAPTQYHSTTGGSVKPPAPP 408
            :.::| :|....|          |:..|.:|    |.|| .:.|.|:|:..|      :...|..
  Fly  2114 QSLNGSIGGGGGS----------VVSSTRTVVFEKDDNS-PRITVTSPSSPH------IHKLALA 2161

  Fly   409 PRTCEKHKPPAKP---PKPEKEKSSGKHCHVGHS 439
            .:....:||..||   .:.|....:|:  |.||:
  Fly  2162 AKAIPANKPDTKPAASTRMELTVPAGQ--HNGHN 2193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssp6NP_001286952.1 PDZ_signaling 130..216 CDD:238492 20/131 (15%)
MhclNP_732109.2 PDZ_signaling 339..426 CDD:238492
MYSc 556..1317 CDD:214580
MYSc_Myo18 575..1305 CDD:276837
GBP_C <1540..1750 CDD:303769
COG1340 1565..1833 CDD:224259 1/4 (25%)
coiled coil 1723..1734 CDD:293879
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.