DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssp6 and CG15617

DIOPT Version :9

Sequence 1:NP_001286952.1 Gene:ssp6 / 38694 FlyBaseID:FBgn0035676 Length:866 Species:Drosophila melanogaster
Sequence 2:NP_611151.1 Gene:CG15617 / 36871 FlyBaseID:FBgn0034151 Length:222 Species:Drosophila melanogaster


Alignment Length:207 Identity:39/207 - (18%)
Similarity:64/207 - (30%) Gaps:78/207 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 EELEMITYVDYVEYGGPAYRAGMREGDVILSINGKDMEKADHKTIVEFIKQCDTRMRMVVLFEDC 220
            ::.|.:|.|: |...|.|.|.|||.||.|..||  |:...:                  :.|.:.
  Fly    52 DQFEPLTIVN-VSPTGLAKRGGMRVGDEITQIN--DVPALE------------------MTFNEA 95

  Fly   221 VRKVDLHMRYIQLQSMLQQKMNELERVHLRERELLEGK--------------------------- 258
            ::....:.||:              ||::|..:...|:                           
  Fly    96 LQMFRKNSRYV--------------RVYVRGDDDAPGEEDWTCDCWFKPRKPWRRDFTPIQWTFP 146

  Fly   259 WKTHSLPARKKANANTSPSDGEGVSPTEVAGEAGFYRPALSTEDVPNIAA-----RQHGVGGPGI 318
            |.....|..|::|....||..|.......|..:..::   ..|..|:..:     |.....||.:
  Fly   147 WNDRRKPVYKESNCFMVPSKMEEKIRARRAATSAVHK---KDELAPHTRSLTPTPRPKNQPGPNL 208

  Fly   319 I--------PPP 322
            :        |||
  Fly   209 LETVLRPRGPPP 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssp6NP_001286952.1 PDZ_signaling 130..216 CDD:238492 16/59 (27%)
CG15617NP_611151.1 PDZ_signaling 30..111 CDD:238492 21/93 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.