DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssp6 and Lnx2

DIOPT Version :9

Sequence 1:NP_001286952.1 Gene:ssp6 / 38694 FlyBaseID:FBgn0035676 Length:866 Species:Drosophila melanogaster
Sequence 2:NP_001101799.1 Gene:Lnx2 / 360761 RGDID:1308222 Length:686 Species:Rattus norvegicus


Alignment Length:137 Identity:36/137 - (26%)
Similarity:54/137 - (39%) Gaps:28/137 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 LDASDEEIEYA-------QLSRSTHILGRHKSERYLASNPDEDR-------------RRRTIIVE 135
            :.||.|.:...       |.|..:...|.|.|..  |..|...|             :.:.|.|:
  Rat   406 IQASGERVNLTIARPGKPQPSNGSREAGAHSSNH--AQPPSHSRPSSHKDLTRCVTCQEKHITVK 468

  Fly   136 KK-NNSYGFTLQSYGIHYKRDEELEMITYVDYVEYGGPAYRAG-MREGDVILSINGKDMEKADHK 198
            |: :.|.|.|:.  |....:..||.:  :|..|...|...|.| ::.|||:|:|||.|:....|.
  Rat   469 KEPHESLGMTVA--GGRGSKSGELPI--FVTSVPPHGCLARDGRIKRGDVLLNINGIDLTNLSHS 529

  Fly   199 TIVEFIK 205
            ..|..:|
  Rat   530 EAVAMLK 536

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssp6NP_001286952.1 PDZ_signaling 130..216 CDD:238492 25/78 (32%)
Lnx2NP_001101799.1 mRING-HC-C3HC3D_LNX2 46..90 CDD:319694
PDZ 229..315 CDD:214570
PDZ 335..421 CDD:214570 3/14 (21%)
PDZ_signaling 462..538 CDD:238492 25/79 (32%)
PDZ_signaling 595..679 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.