DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssp6 and Cytip

DIOPT Version :9

Sequence 1:NP_001286952.1 Gene:ssp6 / 38694 FlyBaseID:FBgn0035676 Length:866 Species:Drosophila melanogaster
Sequence 2:NP_001012086.1 Gene:Cytip / 311047 RGDID:1307990 Length:359 Species:Rattus norvegicus


Alignment Length:250 Identity:63/250 - (25%)
Similarity:114/250 - (45%) Gaps:22/250 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 QSQQQHLYHQSHQQASHYVNGTGSLGRLKFHKSLDASDEEIEYAQLSRSTHILGRHKSERYLASN 122
            ||...:|.:.:....|.|...||.|          ..::......|:.:...|.|.:.:..||.:
  Rat    10 QSSNGNLEYCADSAYSSYPTLTGPL----------TVEDNRRIQMLADTVATLPRGRKQLALARS 64

  Fly   123 PD----EDRRRRTIIVEKKNN-SYGFTLQSYGIHYKRDEELEMITYVDYVEYGGPAYRAGMREGD 182
            ..    ...:|:.:.|||::| ::||.:|:|.:..:.....|:.|.:..|:...||:.||::.||
  Rat    65 SSLGDFSCSQRKVVTVEKQDNGTFGFEIQTYRLQNQNICSSEVCTMICKVQEDSPAHCAGLQVGD 129

  Fly   183 VILSINGKDMEKADHKTIVEFIKQCDTRMRMVVLFEDCV-RKVDLHMRYIQLQSMLQQKMNELER 246
            :..::||...|...||.:|:.|:.....:.:..|....: |:.:|..:...|:..|::|..||..
  Rat   130 IFANVNGVSTEGFTHKQVVDLIRSSGNLLTIETLNGTMIHRRAELEAKLQTLKQTLKKKWVELRS 194

  Fly   247 VHLRERELLEGKWKTHSLPARKKANANTSPSDGEGVSPTEVAGEAGFYRPALSTE 301
            :||:|:.||.|  ...:.|..:..|.:.|...|..:.|:    .|...||.||:|
  Rat   195 LHLQEQRLLHG--DAANSPNLENMNLDESSLFGNLLGPS----PAFLDRPRLSSE 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssp6NP_001286952.1 PDZ_signaling 130..216 CDD:238492 24/86 (28%)
CytipNP_001012086.1 PDZ_signaling 76..161 CDD:238492 24/84 (29%)
Interaction with CYTH1. /evidence=ECO:0000250 166..188 4/21 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340852
Domainoid 1 1.000 69 1.000 Domainoid score I9421
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003007
OrthoInspector 1 1.000 - - otm45672
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15963
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.800

Return to query results.
Submit another query.