DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssp6 and Pdzd11

DIOPT Version :9

Sequence 1:NP_001286952.1 Gene:ssp6 / 38694 FlyBaseID:FBgn0035676 Length:866 Species:Drosophila melanogaster
Sequence 2:XP_038955522.1 Gene:Pdzd11 / 302422 RGDID:1560007 Length:145 Species:Rattus norvegicus


Alignment Length:87 Identity:18/87 - (20%)
Similarity:40/87 - (45%) Gaps:19/87 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 GIHYKRDEELEMITYVDYVEYGGPAYRAGMREGDVILSINGKDMEKADHKTI-----VEFIKQCD 208
            |.:.:..:..::..::..|.....|:|||::|||.:|::|..|.:..:|..:     ||.:|   
  Rat    59 GFNIRGGKASQLGIFISKVIPDSDAHRAGLQEGDQVLAVNDVDFQDIEHSKLCVFQAVEILK--- 120

  Fly   209 TRMRMVVLFEDCVRKVDLHMRY 230
                       ..|::.:.:|:
  Rat   121 -----------TAREISMRVRF 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssp6NP_001286952.1 PDZ_signaling 130..216 CDD:238492 16/71 (23%)
Pdzd11XP_038955522.1 PDZ_signaling 45..130 CDD:238492 17/84 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.