DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssp6 and Grip2

DIOPT Version :9

Sequence 1:NP_001286952.1 Gene:ssp6 / 38694 FlyBaseID:FBgn0035676 Length:866 Species:Drosophila melanogaster
Sequence 2:XP_006506166.1 Gene:Grip2 / 243547 MGIID:2681173 Length:1049 Species:Mus musculus


Alignment Length:414 Identity:81/414 - (19%)
Similarity:133/414 - (32%) Gaps:164/414 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 SNPDEDRRRRTIIVEKKNNSYGFTLQSYGIHYKRDEELEMITYVDYVEYGGPAYRAG-MREGDVI 184
            :||....:...:.:.|:.||:||.|:. |.|....:...::  :.||..||||.|.| ::.||.:
Mouse   150 NNPRIISKTVDVSLYKEGNSFGFVLRG-GAHEDLHKSRPLV--LTYVRPGGPADREGSLKVGDRL 211

  Fly   185 LSINGKDMEKADHKTIVEFIKQCDTRMRMVVLFE----DCVRKVDLHMRYIQLQSMLQQKMNELE 245
            |||:|..:..|.|.|.:..::||.......|.::    |.|                        
Mouse   212 LSIDGIPLHGASHATAIATLQQCSHEALFQVEYDVATPDTV------------------------ 252

  Fly   246 RVHLRERELLEGKWKTHSLPARKKANAN--------TSPSDGEGVSPTEVAGEAGFYR--PALST 300
                                    |||:        .:|....|:|.|     .|.:|  ||::.
Mouse   253 ------------------------ANASGPLVVEIAKTPGSALGISLT-----TGSHRNKPAITI 288

  Fly   301 EDV-PNIAARQHGV--GGPGIIPPPAQFMLTYHYLDPTYRYVLRPTHGSSEEFVDGLGLQRSSSD 362
            :.: |.....:.|.  .|..|:.                              :||     :|::
Mouse   289 DRIKPASVVDRSGALHAGDHILA------------------------------IDG-----TSTE 318

  Fly   363 H--QPPAQRYVLQQTESVDANSMTQPTTTAPTQYHSTTGGSVKPPAPP--PRTCEKHK-----PP 418
            |  ...|.:.:...||.|....:..|.:..|          :|||...  .|:.:.|:     |.
Mouse   319 HCSLVEATKLLASVTEKVRLEILPSPQSRRP----------LKPPEAVRIQRSEQLHRWDPSAPS 373

  Fly   419 AKPPKPEKEKSSGKHCHVGHSCNPCLGHFRW------KSAEKSAVPAPDNVSLDAYDLASPCCDT 477
            ...|:|       .||...          .|      :|...|:.|    .|....:.|.||.:.
Mouse   374 CHSPRP-------SHCRAP----------TWAAGGPDQSRSVSSTP----FSSPTMNPAFPCANA 417

  Fly   478 HCVP---------SRRRHRQHKEH 492
            ..:|         :.||.::.|||
Mouse   418 STLPRGPMSPRTTAGRRRQRRKEH 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssp6NP_001286952.1 PDZ_signaling 130..216 CDD:238492 27/86 (31%)
Grip2XP_006506166.1 PDZ_signaling 58..140 CDD:238492
PDZ_signaling 160..243 CDD:238492 27/85 (32%)
PDZ_signaling 258..341 CDD:238492 20/122 (16%)
PDZ_signaling 463..551 CDD:238492
PDZ_signaling 564..647 CDD:238492
PDZ_signaling 664..744 CDD:238492
PDZ_signaling 947..1026 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.