DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssp6 and GRIP1

DIOPT Version :9

Sequence 1:NP_001286952.1 Gene:ssp6 / 38694 FlyBaseID:FBgn0035676 Length:866 Species:Drosophila melanogaster
Sequence 2:XP_016874587.1 Gene:GRIP1 / 23426 HGNCID:18708 Length:1188 Species:Homo sapiens


Alignment Length:216 Identity:42/216 - (19%)
Similarity:84/216 - (38%) Gaps:50/216 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 AAAVSISASNATSVGSLIAAACQQE-QPHPHQHYSQSQQQHLYHQSHQ-QASHYVNGTGSLGRLK 86
            :..|.:.....|::|..::....:: :|    ..|..:|..:..:|.| ....|:.....:...|
Human   126 STVVELMKKEGTTLGLTVSGGIDKDGKP----RVSNLRQGGIAARSDQLDVGDYIKAVNGINLAK 186

  Fly    87 FHKSLDASDE--------------EIEY----AQLSRSTHILGRHKSERYLASNPDEDRRRRTII 133
            |.     .||              |:||    ..:..|:.|.                 |...:.
Human   187 FR-----HDEIISLLKNVGERVVLEVEYELPPVSVQGSSVIF-----------------RTVEVT 229

  Fly   134 VEKKNNSYGFTLQSYGIHYKRDEELEMITYVDYVEYGGPAYRAG-MREGDVILSINGKDMEKADH 197
            :.|:.|::||.::. |.|..|::...::  :..|..||||.|.| ::.||.:||::|..:....|
Human   230 LHKEGNTFGFVIRG-GAHDDRNKSRPVV--ITCVRPGGPADREGTIKPGDRLLSVDGIRLLGTTH 291

  Fly   198 KTIVEFIKQCDTRMRMVVLFE 218
            ...:..:|||.....:::.::
Human   292 AEAMSILKQCGQEAALLIEYD 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssp6NP_001286952.1 PDZ_signaling 130..216 CDD:238492 23/86 (27%)
GRIP1XP_016874587.1 PDZ_signaling 128..208 CDD:238492 14/88 (16%)
PDZ_signaling 227..310 CDD:238492 23/85 (27%)
PDZ_signaling 325..408 CDD:238492
PDZ_signaling 545..633 CDD:238492
PDZ_signaling 646..730 CDD:238492
PDZ_signaling 746..827 CDD:238492
PDZ_signaling 1062..1142 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.