DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssp6 and Cytip

DIOPT Version :9

Sequence 1:NP_001286952.1 Gene:ssp6 / 38694 FlyBaseID:FBgn0035676 Length:866 Species:Drosophila melanogaster
Sequence 2:NP_631939.1 Gene:Cytip / 227929 MGIID:2183535 Length:359 Species:Mus musculus


Alignment Length:224 Identity:57/224 - (25%)
Similarity:102/224 - (45%) Gaps:35/224 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 RRRTIIVEKKNN-SYGFTLQSYGIHYKRDEELEMITYVDYVEYGGPAYRAGMREGDVILSINGKD 191
            :|:.:.|||::| ::||.:|:|.:..:.....|:.|.:..|:...||:.||::.||:..::||..
Mouse    74 QRKVVTVEKQDNGTFGFEIQTYRLQNQNICSSEVCTMICKVQEDSPAHCAGLQVGDIFANVNGVS 138

  Fly   192 MEKADHKTIVEFIKQCDTRMRMVVLFEDCV-RKVDLHMRYIQLQSMLQQKMNELERVHLRERELL 255
            .|...||.:|:.|:.....:.:..|....: |:.:|..:...|:..|::|..||..:||:|:.||
Mouse   139 TEGFTHKQVVDLIRSSGNLLTIETLNGTMIHRRAELEAKLQTLKQTLKKKWVELRSLHLQEQRLL 203

  Fly   256 EGKWKTHSLPARKKANANTSPSDGE--GVSPT--------------------EVAGEAGFYRPAL 298
            .|  .|.:.|..:..:.:.|...|.  |.||.                    .|..|.| ||.::
Mouse   204 HG--DTANSPNLENMDLDESSLFGNLLGPSPALLDRHRLSSESSCKSWLSSLTVDSEDG-YRSSM 265

  Fly   299 STEDVPNIAARQ--------HGVGGPGII 319
            |.:.:....:||        |...|..|:
Mouse   266 SEDSIRGAFSRQTSTDDECFHSKDGDEIL 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssp6NP_001286952.1 PDZ_signaling 130..216 CDD:238492 24/86 (28%)
CytipNP_631939.1 PDZ_signaling 76..161 CDD:238492 24/84 (29%)
Interaction with CYTH1. /evidence=ECO:0000250 166..188 4/21 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837136
Domainoid 1 1.000 69 1.000 Domainoid score I9602
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003007
OrthoInspector 1 1.000 - - otm43600
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15963
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.800

Return to query results.
Submit another query.