powered by:
Protein Alignment ssp6 and F40F9.3
DIOPT Version :9
Sequence 1: | NP_001286952.1 |
Gene: | ssp6 / 38694 |
FlyBaseID: | FBgn0035676 |
Length: | 866 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_505503.1 |
Gene: | F40F9.3 / 185542 |
WormBaseID: | WBGene00009581 |
Length: | 275 |
Species: | Caenorhabditis elegans |
Alignment Length: | 121 |
Identity: | 24/121 - (19%) |
Similarity: | 42/121 - (34%) |
Gaps: | 38/121 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 343 THGSSEEFVDGLGLQRSSSDHQPPAQRYVLQQTE---------SVDANSMTQPTTTAPTQYHSTT 398
|..:.::..:.:..:.:.|...||..:.::::.| |.::.:...|..:|.|:.....
Worm 153 TESALKDATNEMNEEHTQSVMAPPDVKSIMRKLEAHNFLRKSPSCESAAAPNPVPSAMTKNKEGK 217
Fly 399 G---------------------------GSVKPPAPPPRTCEKHKP-PAKP-PKPE 425
| ..|:|..||.|...|..| ||.| ||||
Worm 218 GERKACILEDGHKSVMIRMDNEENRNKLKKVEPKEPPRRLDPKTPPKPAAPEPKPE 273
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
ssp6 | NP_001286952.1 |
PDZ_signaling |
130..216 |
CDD:238492 |
|
F40F9.3 | NP_505503.1 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3528 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.