Sequence 1: | NP_001286952.1 | Gene: | ssp6 / 38694 | FlyBaseID: | FBgn0035676 | Length: | 866 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_492164.1 | Gene: | gras-1 / 172549 | WormBaseID: | WBGene00009272 | Length: | 245 | Species: | Caenorhabditis elegans |
Alignment Length: | 196 | Identity: | 62/196 - (31%) |
---|---|---|---|
Similarity: | 95/196 - (48%) | Gaps: | 35/196 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 118 YLASNPDEDRRRRTIIVEKK--NNSYGFTLQSYGIHYKRDEELEMITYVDYVEYGGPAYRAGMRE 180
Fly 181 GDVILSINGKDMEKADHKTIVEFIKQCDTRMRMVVLFEDCVRKVDLHMRYIQLQSMLQQKMNELE 245
Fly 246 RVHLREREL-----------------------LEGKWKTHSLPARKKANA---------NTSPSD 278
Fly 279 G 279 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ssp6 | NP_001286952.1 | PDZ_signaling | 130..216 | CDD:238492 | 33/87 (38%) |
gras-1 | NP_492164.1 | PDZ | 67..145 | CDD:238080 | 32/78 (41%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C160159351 | |
Domainoid | 1 | 1.000 | 45 | 1.000 | Domainoid score | I8321 |
eggNOG | 1 | 0.900 | - | - | E1_KOG3528 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0003007 | |
OrthoInspector | 1 | 1.000 | - | - | oto19606 | |
orthoMCL | 1 | 0.900 | - | - | OOG6_113418 | |
Panther | 1 | 1.100 | - | - | LDO | PTHR15963 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R5608 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
10 | 9.770 |