DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssp6 and gras-1

DIOPT Version :9

Sequence 1:NP_001286952.1 Gene:ssp6 / 38694 FlyBaseID:FBgn0035676 Length:866 Species:Drosophila melanogaster
Sequence 2:NP_492164.1 Gene:gras-1 / 172549 WormBaseID:WBGene00009272 Length:245 Species:Caenorhabditis elegans


Alignment Length:196 Identity:62/196 - (31%)
Similarity:95/196 - (48%) Gaps:35/196 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 YLASNPDEDRRRRTIIVEKK--NNSYGFTLQSYGIHYKRDEELEMITYVDYVEYGGPAYRAGMRE 180
            ||....:::..:|::::.::  ..|:||.||||..........|.|||||||....||.|.|:..
 Worm    44 YLFDGINQESAQRSLLLCRQTFETSFGFALQSYVFKRTSSNSYERITYVDYVSADSPADRCGITR 108

  Fly   181 GDVILSINGKDMEKADHKTIVEFIKQCDTRMRMVVLFEDCVRKVDLHMRYIQLQSMLQQKMNELE 245
            ||:::::|.|.:..|.|..|||.|.|| .::.:|::|:|..|.|:|.||.|||:.||..|:.||.
 Worm   109 GDMVIAVNEKSVVTASHAEIVESIAQC-LQVSLVLVFKDVARIVELSMRSIQLRFMLDAKIRELR 172

  Fly   246 RVHLREREL-----------------------LEGKWKTHSLPARKKANA---------NTSPSD 278
            .:...|.:|                       |:.:.|....|..|:||.         |:|.|.
 Worm   173 MLEKTEEDLQALYDDEHGNEEEDESLESTLYELDEELKNVQNPQEKEANGTDYRHLIRINSSTSV 237

  Fly   279 G 279
            |
 Worm   238 G 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssp6NP_001286952.1 PDZ_signaling 130..216 CDD:238492 33/87 (38%)
gras-1NP_492164.1 PDZ 67..145 CDD:238080 32/78 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159351
Domainoid 1 1.000 45 1.000 Domainoid score I8321
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003007
OrthoInspector 1 1.000 - - oto19606
orthoMCL 1 0.900 - - OOG6_113418
Panther 1 1.100 - - LDO PTHR15963
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5608
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.770

Return to query results.
Submit another query.