DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssp6 and FRMPD2

DIOPT Version :9

Sequence 1:NP_001286952.1 Gene:ssp6 / 38694 FlyBaseID:FBgn0035676 Length:866 Species:Drosophila melanogaster
Sequence 2:NP_001018081.4 Gene:FRMPD2 / 143162 HGNCID:28572 Length:1309 Species:Homo sapiens


Alignment Length:425 Identity:84/425 - (19%)
Similarity:137/425 - (32%) Gaps:155/425 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 SHQQASHYVNGTGSLGRLKFHKSLDASDEEI---------EYAQLSRSTHILGRHKSERYLASNP 123
            :|:||...:.|.|.:.||...:.:..|.::.         |...:|..|.:.||..|...:...|
Human  1012 THKQAVQCLTGPGQVARLVLERRVPRSTQQCPSANDSMGDERTAVSLVTALPGRPSSCVSVTDGP 1076

  Fly   124 DEDRRRRTIIVEKKNNSYGFTL----QSYGIHYKRDEELEMITYVDYVEYGGPAYRAG-MREGDV 183
                 :..:.::|..|..||:.    :....|.|.|     :..:..:..|.||...| :..||:
Human  1077 -----KFEVKLKKNANGLGFSFVQMEKESCSHLKSD-----LVRIKRLFPGQPAEENGAIAAGDI 1131

  Fly   184 ILSINGKDMEKADHKTIVEFIKQCDTRMRMVVLFEDCVRKVDLHMRYIQLQSMLQQKMNELERVH 248
            ||::||:..|.                    ::|::.     ||:    |:...|:....|.|..
Human  1132 ILAVNGRSTEG--------------------LIFQEV-----LHL----LRGAPQEVTLLLCRPP 1167

  Fly   249 LRERELLEGKWKTHSLPARKKANANTSPSDGEGVSPTEVAGEAGFYRPALSTEDVPNIAARQHGV 313
            ......||.:|:|..|.|.|:....|...     |.|.         |.|..||           
Human  1168 PGALPELEQEWQTPELSADKEFTRATCTD-----SCTS---------PILDQED----------- 1207

  Fly   314 GGPGIIPPPAQFMLTYHYLDPTYRYVLRPTHGSSEEFVDGLGLQRSSSDHQPPAQRYVL-----Q 373
                                 ::|....|..|      :||||:..||      |:.:.     |
Human  1208 ---------------------SWRDSASPDAG------EGLGLRPESS------QKAIREAQWGQ 1239

  Fly   374 QTESVDANSMTQPTTTAPTQYHSTTGGSVKPPAPPPRTCEKHKPPAKPPKPEKEKSSGKHCHVGH 438
            ..|...|:|:|          ||        |...|..|:.|:        |:::|:        
Human  1240 NRERPWASSLT----------HS--------PESHPHLCKLHQ--------ERDEST-------- 1270

  Fly   439 SCNPCLGHFRWKSAEKSAVPAPDNVSLDAYDLASP 473
                 |.....|...::.....|.:.|..|..:||
Human  1271 -----LATSLEKDVRQNCYSVCDIMRLGRYSFSSP 1300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssp6NP_001286952.1 PDZ_signaling 130..216 CDD:238492 18/90 (20%)
FRMPD2NP_001018081.4 KIND 15..197 CDD:214801
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 214..249
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 266..302
B41 346..550 CDD:214604
FERM_C_PTPH13 546..647 CDD:270008
PDZ_signaling 773..857 CDD:238492
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 859..880
PDZ 947..1034 CDD:214570 7/21 (33%)
PDZ 1078..1167 CDD:214570 25/122 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1204..1228 9/61 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.