DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssp6 and Gm20498

DIOPT Version :9

Sequence 1:NP_001286952.1 Gene:ssp6 / 38694 FlyBaseID:FBgn0035676 Length:866 Species:Drosophila melanogaster
Sequence 2:NP_001296776.1 Gene:Gm20498 / 105940408 MGIID:5141963 Length:182 Species:Mus musculus


Alignment Length:138 Identity:36/138 - (26%)
Similarity:63/138 - (45%) Gaps:24/138 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 NSYGFTLQSYGIHYKRDEELEMITYVDYVEYGGPAYRAG-MREGDVILSINGKDMEKADHKTIVE 202
            |..|.|.|.|   ...|..:    ||..::..|.|.:.| ::|||.|||:||:|::...|:..|:
Mouse    26 NIVGGTDQQY---VSNDSGI----YVSRIKEDGAAAQDGRLQEGDKILSVNGQDLKNLLHQDAVD 83

  Fly   203 FIKQ--CDTRMR-----MVVLFEDCVRKVDLHMRY----IQLQSMLQQKMN----ELERVHLRER 252
            ..:.  |...:|     :||.....:|:.. .:||    |::...|::|:.    .||..:.:.:
Mouse    84 LFRNAGCAVSLRVQHRLLVVGGSFGLREFS-QIRYDAVTIKIDPELEKKLKVNKITLESEYEKIK 147

  Fly   253 ELLEGKWK 260
            :.....||
Mouse   148 DSTFENWK 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssp6NP_001286952.1 PDZ_signaling 130..216 CDD:238492 25/84 (30%)
Gm20498NP_001296776.1 PDZ_signaling 13..97 CDD:238492 24/77 (31%)
COX16 100..164 CDD:372923 12/57 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.