DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssp6 and cytip

DIOPT Version :9

Sequence 1:NP_001286952.1 Gene:ssp6 / 38694 FlyBaseID:FBgn0035676 Length:866 Species:Drosophila melanogaster
Sequence 2:XP_003199223.2 Gene:cytip / 100537036 ZFINID:ZDB-GENE-140106-76 Length:343 Species:Danio rerio


Alignment Length:286 Identity:68/286 - (23%)
Similarity:126/286 - (44%) Gaps:61/286 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 SQSQQQHLYHQSHQQASHYVNGTGSLGRLKFHKSLDASDEEIEYAQLSRSTHILGRHKSERYLAS 121
            ||.::..|:.|....:...:|..|..||            .:..:||:|:      |.:.....:
Zfish    26 SQKKRSILWRQRSFSSPKNLNTEGMKGR------------TLSQSQLART------HSNSLVDYT 72

  Fly   122 NPDEDRRRRTIIVEKKNNS-YGFTLQSYGIHYKRDEELEMITYVDYVEYGGPAYRAGMREGDVIL 185
            :|    :|..:::||::|. :||.:|:||:..|....:||.|:|..|:.|..|..||:..||:||
Zfish    73 DP----QRTMVVLEKQDNEVFGFEVQTYGLKVKNTSMVEMCTFVCRVQDGSAAETAGLTAGDIIL 133

  Fly   186 SINGKDMEKADHKTIVEFIKQCDTRMRMVVLFEDCVRKVDLHMRYIQLQSMLQQKMNELERVHLR 250
            |:||..:|.:.|:.|:|.|::....:::..:....:::::|..:...|:..|::|..||:.:.|:
Zfish   134 SVNGVSIEGSTHQNIIELIRESSNTLKLETVSGSVMKRIELEKKMHYLKQTLREKWVELQSLTLK 198

  Fly   251 ERELLEGKWK------------THSLPARKKANANTSPS---------------------DGEGV 282
            |:.|.:|...            :.|.|..:.....:|.|                     |...:
Zfish   199 EKRLTQGNLNESAQYLSVDSVMSLSSPMGRSGQRFSSDSSCRSIMTDDSEDGAFMSSVFDDSSPL 263

  Fly   283 SPTEVAG-----EAGFYRPALSTEDV 303
            ||.|.:|     |.|..||...|..:
Zfish   264 SPIESSGSFFQLEVGALRPITRTRSI 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssp6NP_001286952.1 PDZ_signaling 130..216 CDD:238492 30/86 (35%)
cytipXP_003199223.2 PDZ_signaling 78..162 CDD:238492 30/83 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580702
Domainoid 1 1.000 67 1.000 Domainoid score I9805
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003007
OrthoInspector 1 1.000 - - otm25599
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15963
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.800

Return to query results.
Submit another query.