DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssp6 and tamalin

DIOPT Version :9

Sequence 1:NP_001286952.1 Gene:ssp6 / 38694 FlyBaseID:FBgn0035676 Length:866 Species:Drosophila melanogaster
Sequence 2:NP_001120354.1 Gene:tamalin / 100145424 XenbaseID:XB-GENE-943584 Length:352 Species:Xenopus tropicalis


Alignment Length:279 Identity:70/279 - (25%)
Similarity:130/279 - (46%) Gaps:56/279 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 SHQQASHY----VNGTGSLGRLKFHKSLDASDEEIEYAQLSRSTHILGRHKSERYLASNPDEDRR 128
            |::||..|    |:| |:|.|.|  |...|.     :..:|:|:                  :.:
 Frog    38 SYKQADMYKALAVSG-GTLPRTK--KGSTAG-----WKNVSQSS------------------EYQ 76

  Fly   129 RRTIIVEKKNN-SYGFTLQSYGIHYKRDEELEMITYVDYVEYGGPAYRAGMREGDVILSINGKDM 192
            |:.:.::|::: |:||.:|:||:|::....:||.|:|..|:.|.||...|::.||:|..:||.:|
 Frog    77 RKILTLQKEDSESFGFEIQTYGLHHQDKNAVEMFTFVCRVQDGSPAQLCGLKVGDIIAGVNGLNM 141

  Fly   193 EKADHKTIVEFIKQCDTRMRMVVLFEDCVRKVDLHMRYIQLQSMLQQKMNELERVHLRERELLEG 257
            :...|:.|||.||.....:|:..::...:|:.:|..|...|:..|.:|..|...:.::|:.||.|
 Frog   142 DGVRHRDIVELIKVSGNTIRLETVYGSAIRRAELEARIQYLKQTLYEKWEEYRSLMVQEQRLLHG 206

  Fly   258 -------KWKT-HSLPARKKANANTSPSD--------------GEGVSPTEVAGEAGF---YRPA 297
                   .:.| .|:.:......||...|              ...:|.||...:|.:   |..:
 Frog   207 IVVKDPSVYDTLESVRSYIYGTVNTCSKDPLTGTLAAGSMCSSASCLSTTEENEDAVYQTCYFSS 271

  Fly   298 LSTEDVPNIAARQHGVGGP 316
            .||:::.::..:.:..|.|
 Frog   272 DSTDEINSLPGKSNNNGKP 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssp6NP_001286952.1 PDZ_signaling 130..216 CDD:238492 30/86 (35%)
tamalinNP_001120354.1 PDZ_signaling 78..163 CDD:238492 30/84 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 67 1.000 Domainoid score I9683
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003007
OrthoInspector 1 1.000 - - otm48760
Panther 1 1.100 - - O PTHR15963
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.