DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6610 and LSM5

DIOPT Version :9

Sequence 1:NP_001261461.1 Gene:CG6610 / 38693 FlyBaseID:FBgn0035675 Length:91 Species:Drosophila melanogaster
Sequence 2:NP_011073.1 Gene:LSM5 / 856889 SGDID:S000000948 Length:93 Species:Saccharomyces cerevisiae


Alignment Length:85 Identity:37/85 - (43%)
Similarity:61/85 - (71%) Gaps:5/85 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 NISTLMPLELVDKCIGSRIHIIMKNDKEMVGTLLGFDDFVNMLLDDVTEYENTP-DGRRITKLDQ 72
            ::..::|||::||.|..::.|::::::|..|||:|||||||::|:|..|:...| |..|..|:.|
Yeast     2 SLPEILPLEVIDKTINQKVLIVLQSNREFEGTLVGFDDFVNVILEDAVEWLIDPEDESRNEKVMQ 66

  Fly    73 ----ILLNGNNITMLVPGGE 88
                :||:||||.:|||||:
Yeast    67 HHGRMLLSGNNIAILVPGGK 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6610NP_001261461.1 LSm5 12..87 CDD:212479 35/79 (44%)
LSM5NP_011073.1 LSm5 6..85 CDD:212479 35/78 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346557
Domainoid 1 1.000 62 1.000 Domainoid score I2504
eggNOG 1 0.900 - - E1_COG1958
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I1658
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54836
OrthoFinder 1 1.000 - - FOG0005804
OrthoInspector 1 1.000 - - oto99735
orthoMCL 1 0.900 - - OOG6_103447
Panther 1 1.100 - - LDO PTHR20971
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3519
SonicParanoid 1 1.000 - - X4194
TreeFam 1 0.960 - -
1413.790

Return to query results.
Submit another query.