powered by:
Protein Alignment CG6610 and SMB1
DIOPT Version :9
Sequence 1: | NP_001261461.1 |
Gene: | CG6610 / 38693 |
FlyBaseID: | FBgn0035675 |
Length: | 91 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_010946.3 |
Gene: | SMB1 / 856751 |
SGDID: | S000000831 |
Length: | 196 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 51 |
Identity: | 13/51 - (25%) |
Similarity: | 30/51 - (58%) |
Gaps: | 5/51 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 23 IGSRIHIIMKNDKEMVGTLLGFDDFVNMLLDDVTEYENTPDGRRITKLDQI 73
|..::.::.::.:..:|.|:.||..:|::|::..| |..|. |:||::
Yeast 16 IDYKLRVLTQDGRVYIGQLMAFDKHMNLVLNECIE-ERVPK----TQLDKL 61
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG6610 | NP_001261461.1 |
LSm5 |
12..87 |
CDD:212479 |
13/51 (25%) |
SMB1 | NP_010946.3 |
Sm_B |
8..98 |
CDD:212464 |
13/51 (25%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1958 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.