DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6610 and SMD3

DIOPT Version :9

Sequence 1:NP_001261461.1 Gene:CG6610 / 38693 FlyBaseID:FBgn0035675 Length:91 Species:Drosophila melanogaster
Sequence 2:NP_013248.1 Gene:SMD3 / 850839 SGDID:S000004137 Length:101 Species:Saccharomyces cerevisiae


Alignment Length:71 Identity:20/71 - (28%)
Similarity:38/71 - (53%) Gaps:3/71 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 MPLELVDKCIGSRIHIIMKNDKEMVGTLLGFDDFVNMLLDDVTEYENTPDGRRITKLDQILLNGN 78
            :|::|:::..|..:.:.:.......|.|:..:|.:|:.|.||...|  |.| .:|.:|||.:.|:
Yeast     6 IPVKLLNEAQGHIVSLELTTGATYRGKLVESEDSMNVQLRDVIATE--PQG-AVTHMDQIFVRGS 67

  Fly    79 NITMLV 84
            .|..:|
Yeast    68 QIKFIV 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6610NP_001261461.1 LSm5 12..87 CDD:212479 20/71 (28%)
SMD3NP_013248.1 Sm_D3 7..76 CDD:212468 20/70 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1958
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.