powered by:
Protein Alignment CG6610 and SMD3
DIOPT Version :9
Sequence 1: | NP_001261461.1 |
Gene: | CG6610 / 38693 |
FlyBaseID: | FBgn0035675 |
Length: | 91 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_013248.1 |
Gene: | SMD3 / 850839 |
SGDID: | S000004137 |
Length: | 101 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 71 |
Identity: | 20/71 - (28%) |
Similarity: | 38/71 - (53%) |
Gaps: | 3/71 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 14 MPLELVDKCIGSRIHIIMKNDKEMVGTLLGFDDFVNMLLDDVTEYENTPDGRRITKLDQILLNGN 78
:|::|:::..|..:.:.:.......|.|:..:|.:|:.|.||...| |.| .:|.:|||.:.|:
Yeast 6 IPVKLLNEAQGHIVSLELTTGATYRGKLVESEDSMNVQLRDVIATE--PQG-AVTHMDQIFVRGS 67
Fly 79 NITMLV 84
.|..:|
Yeast 68 QIKFIV 73
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG6610 | NP_001261461.1 |
LSm5 |
12..87 |
CDD:212479 |
20/71 (28%) |
SMD3 | NP_013248.1 |
Sm_D3 |
7..76 |
CDD:212468 |
20/70 (29%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1958 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.