powered by:
Protein Alignment CG6610 and Lsm2
DIOPT Version :9
Sequence 1: | NP_001261461.1 |
Gene: | CG6610 / 38693 |
FlyBaseID: | FBgn0035675 |
Length: | 91 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001004073.1 |
Gene: | Lsm2 / 684148 |
RGDID: | 1598536 |
Length: | 131 |
Species: | Rattus norvegicus |
Alignment Length: | 42 |
Identity: | 15/42 - (35%) |
Similarity: | 24/42 - (57%) |
Gaps: | 2/42 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 23 IGSRIHIIMKNDKEMVGTLLGFDDFVNMLLDD--VTEYENTP 62
:|..:.:.:|||..:.|||...|.::|:.|.| ||:.|..|
Rat 47 VGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYP 88
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG6610 | NP_001261461.1 |
LSm5 |
12..87 |
CDD:212479 |
15/42 (36%) |
Lsm2 | NP_001004073.1 |
LSm2 |
38..126 |
CDD:212472 |
15/42 (36%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1958 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.